ELF@44 ("444oop   Lp  ((( Qtd/lib/ld-linux.so.2GNU ;+#;<?)K8gUa9w0  \p6LsTj=6zE F*RM~# dl c  .1 E libm.so.6__gmon_start___Jv_RegisterClassesmatherrpowlibdl.so.2dlopendlsymdlerrorlibc.so.6_IO_stdin_usedfflushstrcpyexitreaddirsprintffopenclosedirnanosleepftellstrncpysignalreallocstdintolowerflockstrtolisattystrlenmemsettcsetattrfseekchdirreadgetpagesizestdoutfputcfputsfclosemprotectmallocstrcatopendirgetenvstderrioctlsystemfilenogetcwdfwritelocaltimestrchrfprintftcgetattrtimes__xstatmemmove_IO_getcstrcmp__libc_start_mainsysconffreeGLIBC_2.1GLIBC_2.0:0ii ii  ii Zii ii   = > ;           $  (  , 0 4 8 < @ D H L P T X \ ` d h l p t  x !| " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 :US[xft=X[5 % % h% h% h% h% h % h(% h0% h8p% h@`% hHP%$ hP@%( hX0%, h` %0 hh%4 hp%8 hx%< h%@ h%D h%H h%L h%P h%T h%X hp%\ h`%` hP%d h@%h h0%l h %p h%t h%x h%| h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h% h% h% h% h% h% h% hp% h`1^PTRh h QVh[US= u?   9s   9r []Ít&'U tt $ ÐUWVS]u $lDŽ$|DŽ$xDŽ$tDŽ$p 5  $D$ @BD$D$< $ D$]t$$IX  h x D$ $`{ xG; D$$~   $~  $p~ eʱr  $`\$D$$`h $d  $h$|$g \$D$$`h $d8 $h$x$Lg$x$$l$|-J$|$xJ$x$x$l$e$|$e$蕪 ( -J (  J $|$*e$> ` -$J `   J $d$ p -$J p  , J, $|d$萩 T -$J T   J $%d$9  -$J    J $c$ -$J  p Jp $wc$苨  -$J   J $ c$4  -$J    J $b$ݧ $ -$J $   J $rb$膧  J   P JP -$$b$/ -$J  0 J0 $a$ئ -$J  h Jh $ma$聦 -$J  J $a$*  -$J   4 J4 $`$ӥ p -$J p  $ J$ $h`$|  -$J    J $`$%  -$J    J $_$Τ l -$J l  ( J( $c_$w P -$J P  T JT $ _$   -$J   < J< $^$ɣ  J    J -$$^^$r -$ J   J $^$  -$J   t Jt $]$Ģ 4 -$J 4  p Jp $Y]$m 0 -$J 0   J $]$ -$J  D JD $\$迡 P -$ J P  @ J@ $T\$h $ -$$J $  J $[$  -$(J    J $[$躠 p -$,J p   J $O[$c p -$0J p  , J, $Z$  t J t   J  -$4$Z$赟  -$8J    J $JZ$^  -$<J   d Jd $Y$  -$@J   H JH $Y$谞  -$DJ   J $EY$Y \ -$HJ \   J $X$ < -$LJ <   J $X$諝  -$PJ   J $@X$T h -$TJ h  4 J4 $W$ -$XJ  @ J@ $W$覜 -$\J  ( J( $;W$O  J    J -$`$V$  -$dJ   l Jl $V$衛  -$hJ   l Jl $6V$J  -$lJ   h Jh $U$ T -$pJ T  0 J0 $U$蜚  -$tJ    J $1U$E  -$xJ   | J| $T$  -$|J    J $T$藙 -$J  X JX $,T$@ -$J  8 J8 $S$ -$J  h Jh $~S$蒘  J   J -$$'S$; d -$J d  0 J0 $R$  -$J   J $yR$荗  -$J   J $"R$6  -$J    J $Q$ߖ -$J  J $tQ$舖  -$J    J $Q$1 -$J   J  $P$ڕ -$J  J $oP$胕 -$J  J $P$,  -$J    J $O$Ք  J   4 J4 -$$jO$~  -$J   d Jd $O$' -$J  l Jl $N$Г  -$J   $ J$ $eN$y  -$J   < J< $N$" < -$J <   J $M$˒ P -$J P  | J| $`M$t -$J  x Jx $ M$  -$J   4 J4 $L$Ƒ -$J  J $[L$o , -$J ,  ` J` $L$  J   ( J( -$$K$ l -$J l  J $VK$j  -$J   H JH $J$  -$J    J $J$輏 T -$J T  J $QJ$e  -$J    J  $I$  -$J    J $I$跎  -$J   d Jd $LI$`  -$J    J L D$ D$$p$N D$$`\ $d $h$`D$$t$I$t$$l蠍$p-J$p$tJ$t$t$l$.H$p$H$3  -J   T JT $p$G$܌ J   -$J $qG$腌 ( -$ J (  J $G$.  -$J   J $F$׋ $ -$J $  < J< $lF$耋  -$J    J $F$) Q Q -$$E$؊ -$ Q Q $sE$臊 -$$Q Q $"E$6 -$(Q Q $D$ -$,Q Q $D$蔉 -$0Q Q $/D$C Q Q -$4$C$ -$8Q Q $C$衈 -$<Q Q $$ -$xQ Q $}>$葃 -$|Q Q $,>$@ -$Q Q $=$ -$Q Q $=$螂 -$Q Q $9=$M Q Q -$$<$ -$Q Q $<$諁 -$Q Q $F<$Z p -$J p  J $;$  -$J   ( J( $;$謀 < J <   J -$$A;$U d -$J d  J $:$  -$J   $ J$ $:$h -$Qh Qh $B:$V -$J  h Jh $9$~  -$J    J $9$~  J    -$J $=9$Q~ X -$J X  J $8$}  -$J   T JT $8$} @ -$J @   J $88$L} -$J  J $7$|  J   J -$$7$|  -$J   x Jx $37$G| -$J  l Jl $6${ $ -$J $  J $6${  -$J    J $.6$B{  -$J   ` J` $5$z  J    -$J $5$z  -$J    J $)5$=z ` -$J `   J $4$y -$J   J ${4$y  -$J   J $$4$8y  J    J -$$3$x -$J   J $v3$x L -$J L  H JH $3$3x | -$J |   J $2$w -$J   J $q2$w -$ J  8 J8 $2$.w J  ` -$J` $1$v  -$J   ` J` $l1$v  -$J   , J, $1$)v  -$J   d Jd $0$u  -$ J    J $g0${u x J x   J -$$$0$$u < -$(J <  J $/$t $ -$,J $  J $b/$vt p -$0J p  J $ /$t  -$4J    J $.$s  -$8J    J $].$qs ` J `  ` -$<J` $.$s -$@J  4 J4 $-$r  -$DJ    J $X-$lr < -$HJ <  4 J4 $-$r | -$LJ |   J $,$q H J H  ` J` -$P$S,$gq -$TJ  H JH $+$q -$XQ Q $+$p Q Q $`+$tp Q Q $+$)p Q Q $o$xJ$|J$J $J$J$J$J$J $J$$J($J,$J0$J4$J8$J<$J@$JD$JH$JL$JP$JT$JX$ J\$J`$Jd$Jh$Jl$ Jp$$Jt$(Jx$,J|$0$4$8$<$@$D$H$L$P$T$X$\$`$d$h$l$p$t$x$|$$$$$$$$$$$$$$$$ $$$$$ $$$($,$0$4$8$<$@$D$H$L$P$T$tX$p\$`$ d$h$l$p$t$ x$$|$($,$0$4$8$<$@$D$H$L$P$T$X$\$`$d$h$l$p$t$x$|$$$$$$$$$$$$$$ $$$$$ $$$($,$0$4$8$<$@$D$H$L$P$T$X$\$`$ d$h$l$p$t$ x$$|$($,$0$4$8$<$@$D$H$L$P$T-$X    4$%     8    @@ , L $= L  f 0 :D /0 $ 0 <$  l  X t    l  $   $i   $J           $_BB $<$D$4T  | $ <$ P | h   AD$ $]O=8e@@ x$\ۄ$\$x <$$ $l $$lp     $ $ ^ -D$@JBB BBB$l$<^  -D$DJBB BBB$l$$l$] -D$HJBB BBB$l$g$X$$lm] h -D$LJBB BBB$l$$T$$l]  -D$PJBB BBB$l$$P$$l\ -D$TJBB BBB$l$&$L$$l,\  -D$XJBB BBB$l$$H$$l[ $ -D$\JBB BBB$l$P$D$$lV[  -D$`JBB BBB$l$$@$$lZ 0 -D$dJBB /BBB$l$z$<$$lZ  -D$hJBB BBB$l$$8$$lZ , -D$lJBB BBB$l$$4$$lY  -D$pJBB BBB$l$9$0$$l?Y  -D$tJBB BBB$l$$,$$lX -D$xJBB BBB$l$c$($$liX  -D$|JBB =BBB$l$$$$$lW -$JBB BBB$l$$ $$lW X -$JBB BBB$l$$$$l"W -$JBB BBB$l$$$$lV P -$JBB BBB$l$@$$$lFV  -$JBB BBB$l$$$$lU  -$JBB BBB$l$d$ $$ljU  -$JBB BBB$l$$$$lT $ -$JBB BBB$l$$$$lT -$JBB BBB$l$$$$l T  -$JBB BBB$l$$$$lS d -$JBB BBB$l$>$$$lDS  -$JBB BBB$l$ $$$lR  -$JBB BBB$l$b $$$lhR  -$JBB BBB$l$ $$$lQ 8 -$JBB BBB$l$ $$$lQ  -$JBB BBB$l$ $$$lQ -$JBB BBB$l$ $$$lP  -$JBB /BBB$l$< $$$lBP t -$JBB BBB$l$ $$$lO  -$JBB BBB$l$` $$$lfO p -$JBB BBB$l$ $$$lN , -$JBB BBB$l$ $$$lN  -$JBB BBB$l$ $$$lN -$JBB =BBB$l$$$$lM  -$JBB BBB$l$:$$$l@M -$JBB BBB$l$$$$lL  -$JBB BBB$l$^$$$ldL  -$JBB BBB$l$$$$lK  -$JBB BBB$l$$$$lK  -$JBB BBB$l$$$$lK  -$JBB BBB$l$$$$lJ  -$JBB BBB$l$8$$$l>J  -$JBB B*BB$l$$$$lI -$JBB B,BB $l$\$$$lbI  -$JBB B^BB$l$$$$lH L -$ JBB BDBB$l$$$$lH  -$JBB B<BB $l$$$$lH  -$JBB B(BB$l$$$$lG  -$JBB B#BB$l$6$$$lBB$l$X$d$$l^C -$@JBB B BB$l$$`$$lB p -$DJBB BCBB$l$|$\$$lB -$HJBB BLBB$l$$X$$lB \ -$LJBB BMBB$l$$T$$lA -$PJBB BNBB$l$2$P$$l8A  -$TJBB BFBB$l$$L$$l@D -D$,YAA AdAA$l$Y$H$$l_@ -$XYAA A%AA $l$$D$$l? -$\YAA AVAA $l$}$@$$l?( -$`YAA A@AA$l$$<$$l? -$dYAA A[AA$l$$8$$l>8 YAA A)AA$l$9$4$$l?> YAA APAA$l$$0$$l= -$hYAA AQAA$l$c$,$$li=@ -$lYAA ARAA$l$$($$l< -$pYAA AJAA$l$$$$$l< -$tYAA AcAA $l$$ $$l< -$xYAA AEAA$l$$$$l;@ -$|YAA AGAA$l$=$$$lC;p -$YAA AHAA$l$$$$l: -$YAA AoAA $l$a$$$lg:@ -$YAA ApAA $l$$ $$l9 -$YAA A~AA $l$$$$l9H -$YAA AAA$l$$p$$l9 -YAA AAA $p$l$$t$$l8 -YAA AAA $t$l$;$$$lA8 -$YAA A5AA$l$$$$l7 -$YAA AIAA$l$_$$$le7 -$YAA A8AA$l$$$$l6 -$YAA AAA$l$$$$l6 -$YAA AAA$l$$$$l6 -$YAA A3AA$l$$$$l5 -$YAA AAA $l$9$$$l?5L -$YAA AAA$l$$$$l4, -$YAA AAA $l$]$$$lc4 -$YAA AAA $l$$$$l3 -$YAA AAA?$l$$$$l3 -$YAA AAA?$l$$$$l3x -$YAA AAA$l$$$$l2 -$YAA AAA?$l$7$$$l=2< -$YAA AAA?$l$$$$l1( -$YAA AAA $l$[$$$la1X -$YAA AAA$l$$$$l04 -$YAA AAA$l$$$$l0  -$YAA AAA$l$$$$l0 -$YAA AAA$l$$$$l/ -$YAA AAA $l$5$$$l;/p -$ YAA AAA$l$$$$l.h -$YAA AAA $l$Y$$$l_. -$YAA AAA $l$$$$l-4 -$YAA AAA?$l$}$$$l-t -$YAA AAA$l$$$$l- -$ YAA AAA $l$$$$l, -$$YAA AAA$l$3$$$l9,t -$(YAA AAA$l$$$$l+ -$,YAA AAA$l$W$$$l]+t -$0YAA AAA$l$$$$l* -$4YAA AAA$l${$$$l* -$8YAA AAA$l$ $$$l* -$<YAA A*AA$l$$|$$l)  -$@YAA A,AA $l$1$x$$l7) -$DYAA A^AA$l$$t$$l(@ -$HYAA ADAA$l$U$p$$l[( -$LYAA A<AA $l$$l$$l' -$PYAA A(AA$l$y$h$$l' -$TYAA A#AA$l$ $d$$l' -$XYAA A9AA$l$$`$$l& -$\YAA AAA $l$/$\$$l5& -$`YAA A&AA $l$$X$$l% -$dYAA A;AA $l$S$T$$lY% -$hYAA ASAA$l$$P$$l$ -$lYAA A!AA $l$w$L$$l}$ -$pYAA AAA $l$ $H$$l$ -$tYAA AOAA$l$$D$$l# -$xYAA A>AA$l$-$@$$l3#4 -$|YAA A AA$l$$<$$l" -$YAA ACAA$l$Q$8$$lW" -$YAA ALAA$l$$4$$l!D -$YAA AMAA$l$u$0$$l{!d -$YAA ANAA$l$$,$$l ! -$YAA AFAA$l$$($$l \ -$YAA AdAA$l$+$$$$l1  -$YAA A%AA $l$$ $$l -$YAA AVAA $l$O$$$lU -$YAA A@AA$l$$$$l -$YAA A[AA$l$s$$$ly -$YAA A)AA$l$$$$l  -$YAA APAA$l$$ $$l -$YAA AQAA$l$)$$$l/ -$YAA ARAA$l$$$$l -$YAA AJAA$l$M$$$lS -$YAA AcAA $l$$$$l -$YAA AEAA$l$q$$$lw@ -$YAA AGAA$l$$$$l  -$YAA AHAA$l$$$$l -$YAA AoAA $l$'$$$l- -$YAA ApAA $l$$$$l -$YAA A~AA $l$K$$$lQ -$YAA AAA$l$$$$l -$YAA AAA $l$o$$$luH -$YAA AAA $l$$$$l -$YAA A5AA$l$$$$l -$YAA AIAA$l$%$$$l+ -$YAA A8AA$l$$$$lP -$YAA AAA$l$I$$$lO -$YAA AAA$l$$$$l@ -$YAA A3AA$l$m$$$ls -$YAA AAA $l$$$$lt -$YAA AAA$l$$|$$l -YAA AAA $|$l$#$x$$l)x -YAA AAA $x$l$DŽ$l$ -$YAA AAA?$l$JDŽ$l$S -$YAA AAA?$l$DŽ$l$ -$ YAA AAA$l$tDŽ$l$} -$YAA AAA?$l$ DŽ$l$D -$YAA AAA?$l$DŽ$l$ -$YAA AAA $l$3DŽ$l$<0 -$YAA AAA$l$DŽ$l$ -$ YAA AAA$l$]DŽ$l$f -$$YAA AAA$l$DŽ$l$` -$(YAA AAA$l$DŽ$l$ -$,YAA AAA $l$DŽ$l$%0 -$0YAA AAA$l$DŽ$l$ -$4YAA AAA $l$FDŽ$l$O -$8YAA AAA $l$DŽ$l$ d -$<YAA AAA?$l$pDŽ$l$y  -$@YAA AAA$l$DŽ$l$  -$DYAA AAA $l$DŽ$l$  -$HYAA AAA$l$/DŽ$l$8 L -$LYAA AAA$l$DŽ$l$   -$PYAA AAA$l$YDŽ$l$b | -$TYAA AAA$l$DŽ$l$  -$XYAA AAA$l$DŽ$l$  YAA AAA$l$ $$l& T$@QT$DQT$HQ T$LQT$PQT$TQT$XQT$\Q T$`Q$T$dQ(T$hQ,T$lQ0T$pQ4T$tQ8T$xQ-$A` Y ` $$-$AL Y L $蜩$-$A Y  $U$i-$A l Y l $$"-D$|A  Y  $ʨ$-D$xA  Y  $膨$A Y  -D$t$B$V-D$pA Y  $$-D$lA$ Y $ $躧$-D$hA  Y  $v$-D$dA L Y L $2$F-D$`A Y  $$-D$\At Y t $誦$-D$XA Y  $f$z-D$TA  Y $"$6-D$PA  Y  $ޥ$-D$LA Y  $蚥$-D$HA Y $V$j-D$DAL Y L $$&A Y -D$@$Τ$-D$  $I P $X  $a  $p | ~$   m$ L \$  K$  :$  )$ d $ǡ  $ҡ  $ܡ 0 $  $ ` $  $  $ 0 $  $& D n$8  ]$K  L$V  ;$c  *$t x $  $ t $  $ @ $  $ P $  $Ģ  $Ӣ  $ۢ H o$  ^$  M$  <$  +$+  $3   $; @ $@  $K  $  $T  $V  $\  $c  $v  p$}  _$  N$  =$ \ ,$  $ d  $ D $  $ã 4 $ӣ  $  $  $  $  $  q$0  `$9  O$C  >$L  -$W  $_    $e  $p  $z  $ t $  $ t $  $  $Ȥ t r$Ӥ 4 a$  P$ h ?$ p .$  $   $ 4 $ X $ ( $ < $  $O x $*  $1  $9  s$B , b$F L Q$L  @$U  /$V  $^   $g  $n  $v  ${  $  $ H $  $ @ $  t$ p c$ @ R$  A$  0$j  $ @ $ť  $ɥ  $Υ 8 $ե  $  $ۥ  $ D $  $  u$ \ d$  S$  B$  1$ |  $  $ ( $ x $o D $, x $2  $: \ $A  $J  $  v$   e$O  T$¢  C$S  2$Z  !$]  $`  $#  $f  $l  $a   $p , $s p $  $z t w$  f$  U$  D$^ 8 3$  "$  $T  $z d $  $  $ $ $  $  $ P $  x$Q X g$ʦ  V$  E$  4$  #$ , $  $ 0 $Ʀ  $ɦ $ $E  $ͦ h $  $æ   $Ҧ  y$  h$  W$  F$  5$  $$@ P $ l $d  $!   $ m $  Z$.  詿$2 4 蘿$4  臿$:  v$@  e$F  T$\  C$ t $  $ $f  $\  $̝  ۾$l  ʾ$՛ ( 蹾$ћ x 訾$p  藾$s  膾$v  u$x x d$  S$ H B$z  1$ `  $ H $  $` | $ 4 ܽ$ < ˽$  躽$  詽$ 4 蘽$Ƨ  臽$D ` v$l  e$  T$٧  C$  2$ܸ  !$ p $(  $P $ $  ݼ$ < ̼$  軼$ x 誼$  虼$8  舼$h d w$  f$ , U$*  D$@ ` 3$غ  "$ ` $D  $Y 8 $l  ޻$  ͻ$  輻$  諻$ | 蚻$@ H 艻$d L x$  g$  V$  E$@  4$|  #$  $  $u  $$  ߺ$ ` κ$  轺$H  謺$  蛺$̾  芺$ ` y$@  h$p  W$  F$п  5$ $ $$˨ l $  $ۨ x $  $  Ϲ$'  边$@  譹$,  蜹$:  苹$V @ z$b T i$k  X$s  G$| X 6$  %$  $  $  $© h $ԩ  и$ݩ h 迸$ $ 许$P  蝸$  茸$ d {$}  j$ < Y$% ( H$0  7$A  &$M p $]  $ < $q $ $  ѷ$  $  请$@ T 螷$  荷$ \ |$  k$ L Z$0  I$-  8$P  '$ d $  $   $  $4  Ҷ$ H $  谶$` ( 蟶$ ` 莶$  }$ 4 l$Ѫ x [$ | J$ P 9$ < ($8 $ $4 l $l  $\ d $  ӵ$ 4 µ$  豵$  蠵$  菵$  ~$  m$  \$  K$   :$,  )$  $  $3  $|  $t  Դ$  ô$  貴$'  衴$L  萴$  $ 0 n$(  ]$E h L$T 8 ;$b X *$  $ | $  $ 0 $D h ճ$l l ij$ l 賳$  袳$ ( 葳$v @ 耳$  o$<  ^$h  M$  <$ H +$ d $   $   $ , $ǫ  ֲ$٫  Ų$  贲$ @ 裲$ D 蒲$  聲$* p p$, t _$E  N$P  =$\ < ,$t T $k (  $  $ $ $y p ױ$ 4 Ʊ$  赱$ h 褱$Ŭ 0 蓱$ P 肱$  q$@  `$ $ O$  >$  -$  $ݬ   $ p $  $+  ذ$  ǰ$@  趰$! T 襰$R , 蔰$- p 胰$^  r$; ` a$l  P$X ( ?$| 8 .$O   $R x  $^  X Ð\$@|$@CxE|$$D$h |$$'wh $h $}}b T$D$h $vh $v$wCT$Ct^}EE}t,1[^_]Í$W,1[^_]ÍD$@$WT$됍 <C$虢Cz  J\$@L$@CJ tW t$$igD$N{Ǎ,CT$<$VT$vT$4$VT$v<$V럍,\$ |$$|$0t$ l$(uW41ۋFF}1\$t$ |$$l$(,Í$4eFz l$$igD$JzË $D$tJD<$U7t&<$xUv$hU/v \$$ D$`f,$`UlS(\$0$1\$8҉uD$$TD$([Í&'UWVS<|$PD$ $=t 4=| t  t =}=|$. t D$. fD$,l$,\$l$.D$ t 두uj؍4 FFt?}t <[^_]É,$S<[^_]Í<$S뷍|$.D$. fD$,l$,|$ l$.D$ t |p-?k xTl$D$$ Ł}:|$.D$. fD$,l$,|$ l$.T$ Љt v-t 덶 $ S(\$0$0\$}҉t ([Í$D$RD$([Ít&'S(\$0$.\$}҉t ([Í$D$TRD$([Ít&'S(D$0=}>|$T$ fT$l$\$l$\$҉t؉D$$([Í$Qٍ&'UWVS<\$P ,)Ł}B|$.D$. fD$,l$,\$(l$.t$(P/<)ǁ}B|$.D$. fD$,l$,\$(l$.\$(,߁.U4)Ɓ}B|$.D$. fD$,l$,\$(l$.T$(ցK)Á}B|$.D$. fD$,l$,\$(l$.L$(HˉT$$T$iyq Y} ɉ t<-[^_]Í&D$ $dOD$ ׍D$\$$Є$SD$D$ 5L$ JT$$NT$ T$x D$x $T$ x D$x $͌D$\$$$SljD$4@$ N& x D$x $%D$t$$@$SD$D$3T$|n4$aMt& x D$x $}y$Llf<$LfT$ $LT$f<$Lv,$L5v$T$L$ pLL$ T$T$4$TLT$v|$.\$(D$( D$.fD$&l$&l$. D$. fD$,l$,\$(l$.T$(t&|$.\$(D$( D$.fD$&l$&l$. D$. fD$,l$,\$(l$.t$(Zt&|$.t$(D$( D$.fD$&l$&l$. t"D$. fD$,l$,\$(l$.\$($踸p$訸$蘸UWVS, t$@ I(}҉ |$T$ fT$l$\$l$T$,}'|$D$ fD$l$\$l$l$11}xBBudt& @ =}'|$D$ fD$l$\$l$D$9tA}u$Iu,1[^_]É $nI9ufe` <t$跔  8 q }҉c}<t$*B r =}B1}.4$H,1[^_]Í&,} <,_(}҉U'w Q} Q҉Q} 0$F&L$$FL$1v҉-$F f|$D$ fD$l$\$l$D$M$jF$]F$PF  <4$1F$F$Fv$oV$EI'VS< D$ $ D$EP <4t$ <t$躐BB=}҉t [^Ðt&$D[^Ð&UWVS< \ H  qH}'|$.L$. fL$,l$,\$(l$.t$(}1ې} , y}҉E1ۅà (p4|$.D$. fD$,l$,\$(l$.t$( ,  <ƍt$踎 8,<t$聎B B =}҉ <t$'   \ < H ɉ P} <tT$$$蜍T$$ Bz=}҉ <t$D \  <tT$$$ T$$ BHrH= <t$ƌ  t D$<t+D$T$$$~T$$ t D$D$BJ=}҉ <t$  <tT$$$T$$ BB=}҉ <t$舋 (U<t$YUBB=}҉o}u}u<$Y?<[^_]Í&$@?vD$|$$tH/<$>'tntMBB$>v$>v$>Dv,1 ҉$5>$(>$>$>R$>}T$$$=T$$$=$=t&'UWVS<= 11D$$fD$PT$\$$tT$} ɉ Og}F 4@=}'|$.D$. fD$,l$,\$(l$.D$(|$$ǡ l$$D$  [ } ɉ t79\$P0|$P&T$$<T$뷍D$ T$$;D$ T$1;=  <t$T$$5T$  l$$( L$$  Y} L$$L$$ɉ }M<tT$$菆T$MAY=} ɉ   <t!T$$2T$  (ՋU<t$U  BJ== |$P}T$PMt&}O<[^_]Ðt&T$4$9T$1  <Ǎt$* (݋U<t$UB B =}҉ <t$虄 (݁|$P} L$PU<t$RUL$PBJ=}҉= <t$ <t$˃  BJ=}҉|$P= T$P$7f$7f4$7<[^_]Í҉!$o7$b7fK$S7v$C7vT$$/7T$$7T$$ 7T$/t&UWVS<= 11D$$fD$PT$\$$T$} ɉ Og}V 4@=}'|$.D$. fD$,l$,\$(l$.D$(|$$ǡ l$$D$E  [ } ɉ t79\$P0|$P&T$$T5T$뷍D$ T$$85D$ T$1;=  <t$T$$uT$  l$$( L$$  Y} L$$L$$ɉ }M<tT$$T$MAY=} ɉ   <t!T$$rT$  (ՋU<t$=U  BJ== T$P}}"u $-3t&<[^_]ÍT$4$ 3T$1; <Ǎt$Z~ (L$P݋U<t$~UL$PBJ=}҉ <t$} (݋U<t$}UB B =}҉: <t$3} <t$}  BJ=}҉T$P= t;4$0<[^_]Ít&$0|v҉)$0$0[$0<$0T$$0T$$n04$a0 T$$O0T$1UWVS,l$H|$@}B|$D$ fD$l$\$l$\$I݁|$L}LD$LT$L|$D$ fD$l$\$l$\$\$L|$T}HT$T|$D$ fD$l$\$l$\$s\$TD$$nƃ<؉t$zًP@}؃{t$3zƉ؋ Qy} ɉ {t$yًPh}{t$yƉ݋B B =}҉]}t,$EyƉ؋MQA} ɉ xt$x݋ BJ=}҉}t,$xƉ؋Ml$LQ$i$} ɉ xt$Kx݋L$DB0J0=}҉c}t,$wƉڋMA4A4=} ɉ  zt$wƉ؋ l$XQ8i8} ɉ xt$Uw݋L$PB(J(=}҉}t,$wƉ؋Ml$TQ i } ɉ t xt $vt AQ=}҉]C t$$ D$x5-P   <t"$v-P  R(M<tT$$uT$MAQ=|N P t`} CCt3P ,[^_]Í҉u$)듐4$)P ,[^_]Ív<$)떍,$)vL$$)L$Tv$p)vD$$\)D$v$H)vD$$4)D$Pv$ )vT$$ )T$vD$$(D$vD$L$(B&D$T$(|&L$$(L$vD$$(D$v$(v$p(vD$$\(D$v<\$,\$@t$0|$4l$8}B|$D$ fD$l$\$l$t$! $D$\t* \$,t$0|$4l$8<Í <ƍt$ s (<U<t$rUB B =}!҉u $'t& <t$qr 8<t$CrBZ=}҉u $&f \$$ D$. t$$ D$.  $\$D$u3 |o    \$D$$V}t $%v$%\$D$$([$SljD$ [B<$W%5fUWVSKv<3]Bt&<$( v4$ v$ vT$$ T$av$ fv$T$ T$$ av4$ "vT$<$ T$v4$p v<$` Cvffv4$t&3 v"v<$ VD$D$$ AD$D$$ lANj`&'UWVS\|$t}LD$tT$t|$ND$N fD$Ll$L\$Hl$N\$H \$t  } ɉ { \$p D$pC\$@$/D$<T$ T$T$($D$ T$(|$4}L$4 T$(|$$ D$ T$(l$4t&=}ɉ T$02 R } ɉ  T$T$($D$"T$(fL$pՋ|$4}!T$4u$|}Pv}D$,\[^_]ÍvT$($T$(PvT$($T$(v$vL$0} qJ {=} ɉ ! t%=}҉$  L$< L$@D$pA\$\$} D$\=}҉l1[^_]fT$($T$(@vT$($T$(vT$($|T$(v 9|k=|dp 9B"= 9t'| =YD$$EL$<  !D$$uD$< fT$(<$T$(v$?v$vT$(<$T$(v$x $`v$Pv,$@v,$0$$#l1[^_]ÉD$$T$< &4$$4$v<$v 9tV|>=|7 9t|=}SD$$ouCT$< D$$PuD$<8 ~  PL 9t|=}D$$uL$<  1@ 9t'| =D$$D$< vWVS |$  q}҉ 4$D$}up  Y}҉X \$$D$t+}1[^_Ð}W  Y}҉$@3Z t$$igD$ Ë$Žt&$1[^_Í&$ v$xv4$h4v ZO$=B$0v4$ Yv$ 1 8 t  Ít&'-l 1ÍD$ ~ Ív t&~& tP-@xT$ D$ \$ SfÐЃÍv'UWVS,T$@D$@,D$ wT$@11ۿ@0&94}oL$X-0@x\$D$$|$T$ fT$l$\$l$L$҉tmȃ9҉D$4$D$9D$D$ $ZRvL$$L$끍u\$D$$R3$Qt&$XvL$@҉to|'}҉t2,[^_]f҉uĉD$$D$벐4$D$D$,[^_]ÉD$ $D$|t녋L$@ $[' T$ntD\\t?t t8""t1''t*r t#< D$ Et& Í&t $1fS l u l l ؃[Ív'UWVS$1T$<$t/T$v&l$1Ƀ.T$\$D$P  4/D$L$$l$ t&l$,4D$,4$rN$ZN} $!NFFD$PT$D$ 4T$/L$$}9D$nЁ0@xl$,D$,L$$ML$Ł44$dM,$T$4$9T$&1l$T$1ɉ\$D$ D$P҉8|$}t${}o} <[^_]f}e.\$PE<-+D$/9y40,L$ v/}99<7-@x\$,D$,$qKÁ{}B|$*D$* fD$(l$(\$,l$*t$,D$P4()L$ |$4} L$D$ $t$ $JL$|$}T$4 4ơ  $*J}ҋ҉uD$4$qD$뫍v1ۃED$T$P44}҉E҉,D$$D$ |$}T$ $fT$$L$$PL$&L$<$49L$&l$ 1\$$\vL$$L$|$t&<$L$$L$ @ $D$H}V҉V 1=h T0 D$T$T$H$ T$LJT$H1D$L ɉL$,}}T$H1 tL}44 11ۃ t"D$Lf D$,$\$9|$,}PT$H ;0 D$D=}҉D$L҉T$D}҉{T$H2f$D$L&$8v$Xv|$(\f!=}҉JD$L-  D$$T$DT$}D$L}B4}0 D$ D$D$D$z|$D4$|$҉D$D<$D$DD$L|$(t&$&v4$D$LD$v$vL$DT$|$(҉L$Q҉T$D.` D$8D$0D$D$T$0D ,$T$4 D$D$L$ T$L}% ɉ u$ vD$L&1`  D$,$D$0D T$8D$4D$< D$@D$0D$ D$D$L$s}o    ɉ   0 $D$҉|$H$ ` J J  }J D -JD$ $igD$d$$m\[^_]Ít&L$ $L$ (v$ ` J JL$H}J  }J D -JD$ $igD$=0 $D$f=K҉A*t&L$ $ D$LT$HL$ v    D$$\$$L$ 4$L$ v}҉T$HË L$,|$,D$H  D$$|$E'N&$t&vv<$v$v` $igD$ D$lj$jc ɉ $  $pD$LL$ $TT$HL$ <$5D$H$$   D$ $D$ =$ <$$D$ T$HD$ ÉL$,\D$DZ&UWVS<L zD$,` $D$( 4aT$(<D$ T$$D$$T$(@\$$xƋ\$ }b \$ 484$?ËL4$l?&$X\$ k` $|$ }T$ . 8T$$諶T$9˸t(wL$L$$藡L$}҉=  <t$ =  8<t$ Bj=}҉D$,$|$(}T$(b}t&/}<1[^_]Ít&4$Hv0ftvL$$L$Gv} u $vP <C$  J  J  J J J  J  J 8 J  J$P \$$P D$D$,=  P  ` D$ $ D$ =   <t$7 =  8<t$  BJ=}҉u $A|$( T$(s$fD$ $D$iv$ؼvX<$诼Kf4$蠼<1[^_]Í $c\ $kc;$H$;$.Q'VS4D$@u 14[^Ív=u'#}Z -@x\$,D$,$0)D$'\$$֛N5 }? =]@xD$,D$,$(=%t T$@ t =}҉D$@   eЉ@xD$,D$,$)(=t  d ?i'3@xD$,D$,$'T$@ ɉ D$$йD$4[^Í|$*T$* fT$(l$(|$ l$*T$ t  =/҉$荹 f v|t t }9|$*t T$* fT$(l$(\$l$*T$t 뎍|$*T$* fT$(l$(|$ l$*T$ t T$@$  D$PD$D$@D$$hD$@j&|$*T$* fT$(t l$(\$l$*L$ +v$ ;v$ t&$D$@)T$,D$,$a%t&t$,D$,$A%p҉WD$$耷D$B&\$,D$, $$vD$,D$,$$t&$'d } ɉ } D$D$$0tD =}D$d $d D$Z #vD $]륐D$$tD$nT$@H/$ 1"vUWVS< D$,- =8 11| L|,EX}9Ӹt&| 0}\$$u}҉lEX f 19 10EPT$T$D$$ zT$Ë | }.T$T$\$$ T$} 19  D$1|$l}! Ehwl$t$$kË}8tBBu $zf| |$}*L$҉u $9| T$,l$D$$ Ƌ9| }xt$3| T$2=|҉c$lV& }8 T$, $DBBB BT$,D$,T$\$$u$謱| T$,@$`D$,$L$,}J  J rJ | =}҉$6-zB| D$,=}҉1}}<1[^_]Ðt&tCv t+T$$T$D$,$ۯ,E.} u $˯vD$1ۋl$,,$~D$,$L$,}J  |$J rJ }L$?| 0}D$t$$&} | 4B<t!T$$T$ |  )=| T$D$$| D$ڸT$BBu,$ <$&f}D$,T$\$$bt&,$D$,& ɉ ,T$$kT$f \$$D$‹$vD$$D$v $Ьv,$萬:v$谬<1[^_]Í4$蘬v$XvY19Ívvf -@L$D$$vZ?O\$D$$8v| BT$l$D$$| 舶T$& L$L$$D$;L$D$t|$8T$'u?rt$D$$ơ| St&4$fvT$$T$v,$+v$v $ЪIvL$$輪L$\v$訪v,$蘪D$D$$ ơ|  D$$D$ D$D$$ VD$t$$BfS  T =}҉ $= }@Jl < tD$ D$$ ,G1[Ë B=|ȣ 릍&ۉuۉ$ ǐt&$Bt&'U1WVS1ۃ$Co}$BZN=-l =}҉u$$>BB=-l =}҉u$$BBh蚳=>D$,}t$$VT$Ëu$}u4$Ί<p}D$t$$juYt<$ÉBB=}҉t1v$1=gf}u4$p}D$t$$4ju9t<$RÉBB =K1}u4$肉p}D$t$$iu9t<$ÉBB =1G}u4$p}D$t$$ipt<$t&+ÉBB=$1 = h $Y/a$ `4$/$"f[D$,|$,\$<$D$賒á ,D$,\$<$D$耒ˤ$BBo$BBN$BB- $_.$nBT$$$T$P$v4$vlj$l<$趆4$詆4 $-8C&'UWVS, P T  } ɉ P  =}҉D$$s  D$D$9$0 踳  D$D$z$a蒳  D$D$Z$Al  D$D$$Fx   duԡ ǀ @$ ǀ  ǀ  ǀ  ǀ ǀ ǀ ǀ ǀ ǀ ǀ ǀ @4 @( ǀ ǀ ǀ ǀ ǀ ǀl ǀt ǀ ǀ ǀ ǀ ǀ ǀ @h @h, =}҉2D$$, 1-vt, 2_tՋ =,2}҉te$BB|$,$҉[D$<$OD$F$h둍=}҉t ,1[^_]É$2,1[^_]É$$ $рVS$D$v۝ t t T$} ɉ D$t$vD$\$4$D$,wál $D$褴t蛙D$D$t $Vu D$$[^ÃD$D$T$  D$$3 t uǐD$$[^Ð$ IUWVSL|$`}B|$>D$> fD$\$8%߉<$4輕  i}҉ ,$D$X}1@ 0 ՉT$4{(Q\$,})|$>|$> f\$|$8\$4ɉKhL$,UY} U҉Uu 4,}}}|$D$l$D$ D$D$$Mǡ 4>=4 <t$   <tT$0$T$0 BB=}҉ <t$|  <tT$0$HT$0 B B =}҉C <t$ 0<t$B$B$ =}҉}}t7L[^_]Ðt&҉${f,${L[^_]Í$p{Bv<$`{v$P{0v$@{v$0{&v$ {7v,${v${ 0, L$,`$z~vUWVS|$D$ fD$l$\$l$t$ts <t$肹 T$0=}҉t$1[^É$m$1[^É$m냍D$ $ D$ D$0x1Ív'D$ $ D$ D$x1Ív'D$ $ D$ D$w1Ív'D$ $ D$ D$w1Ív'S(D$0=}>|$T$ fT$l$\$l$\$҉t؉${1 ([f$plٍ&'D$> fD$\$8ރ:A$;e 4$D$Z4$1f1 D$ D$$$݉5 dD$L$d<$d|$$}}P|$ }!L$ u $U^\1[^_]Ív1$Jd1u$2d/a f<$  d <$c/M$cD$$4$,$E1D$ 11f-8  $l$,c T$,,@P=D$(}#|$>D$> fD$L$,1; \ D$ $gT$,$<$c +\$(ف@x\$8D$8$YÁK{?$b,$b D$$t$0&|$>T$> fT$T$8$|$>D$> fD$< l$<\$8l$>T$8<<$D$\$$ 9<ʼn$at$\$$<} k$  <<$c-?ol$8D$8$X&4$0[v$1.a= +$a    D$$\$= $` 0}4$.4$`tO$` 8}<$<$D`4$4` xf-?x|$8D$8$ǁw|}B|$>D$> fD$l$8<$1_ t$D$$$1D$ f\$D$$ lj$^_,$V_ D$$t$0t$$6v<$Ycv$t$0_<$^    +D$($D$D$݈ T$,Z$}$1^D$\$$81҅r mlj$3<$11Hf,$(Xv<$XrvD$( ۉ    $D$T$5 ,$WE ?]6$1]=  1u$]=  $f] 8}<$<$D$ )]L$ D$$D$( $\ R T$$}$\T$$D$$T$6 L$$ $\ j8s$C\ l$$D$誋,$D$$\|$$[D$$Q$[ R8,ET$$[ T$D$ E|$>l$ D$> fD$L$8E,$][P2 AT$,$L$,[- T$L$|$>D$> fD$L$8E,$ZP8T$,$ZT$ T$T$$D$T$D$ $Zl$ t%|$ }D$ t t&\4$$1L$( $<$  <$ |$1$ D$^1T$(1$$Ya <$Y L$(z [$YW1D$ <${YT$ $gY T$$z  $YD$|$$臈É<$X} <t$+ T$$$T$,X L$(RT$$G$NXGD$,<t$蛝L$,L$$BJ=}҉4$0D$($Tg&`lat& e $W $|W\#$_WD$(D$,D$$$1u1D$ D$$L$$T$,$D$($sL$1 L$$5 VD$L$V$VL$ $xPv$tV j $7VD$l$$蟅,$D$ V|$ D$ T$$$U j}$U,$UD$$3D$$\!t&D$ D$$ 1,$1St&$8UD$|$$蠄<$D$ U|$ D$ D$$v$T1;- ,$D$$TD$$D$ At&$TM1D$ ,$pTL$ p&,$PT +\$(݁@x\$8D$8$覻ÁS k?F $S$S D$ 1t$$|$>T$> fT$T$8  q}҉$} |$>T$> fT$T$8  q0}҉G\$t$$ہ} 4$OtFF  5|$>T$> fT$T$8$ <ƍt$ |$>T$> fT$T$84 <<$L-?sxt$8D$8$hƉ$PD$ \$$D$+ } ,$$ePqw=  1$.P= D$$Åu0$ PT  <D$$$`,8 $O4$IfvD$\$$ )D$t$$t/f$ Ivf9fv(|$8D$8$h{$HXv4$Hfv,$Hvt$$$N|&$N z v$SND$|$$}<$1N\&$M Z$MD$$$MD$$$M Z$QMD$$!($1MD$$KP 1D$ 1$LD$$1&$L눐4 <&<$yFq$4$[F.$^L31ۃ@T$,$9LT$t1; D$ ,$T$ LT$  ,(T$$K  T$,l$ ((=  G1$pK= D$$Åu,$NKT  <t0D$$$aA$:"=D$$XD$ 11D$$$J1ۃÉ<$J1=  W$J1= D$ D$$u]$rJT  <$JJT  <kD$ $e1c8 $11D$(D$,D$$$1$1D$ \$D$$ -yʼn$I$I D$ }$ucI D$u$D$ D$$ 1lD$l$1D$ D$$ -8 D$L$H $D$LH~keÍD$L\$D$D$L$-M9|:4}҉t뻉$D$GBD$맋D$L$$-H$%HD<$  l$ ‰$1D$$<$A$Gyl$8D$8$3$G D=}'|$>D$> fD$D$8$C$`18 $1D$ D$$$G 8}<$j<$F=  $F st$$D$$ ,$l rD$r$D$ D$$$+F D=}'|$>D$> fD$D$8 ,z $ED$|$$ u<$D$$}E|$$D$$u^$QE (z}$E<$EA$a1A8 $d1D$ $,$h$Dl$ ~`t$$މl$ D$L$9|'}ۋuƉ$>>뼋t$$\$ O$D$T$ *4$D xw-?x|$8D$8$wǁw |$>D$> fD$l$84$=D$($$qCD$ qD$$$CC D=D$ }#|$>D$> fD$ L$ T$ T$$z $BD$|$$r<$B$fB T$$z}$)B<$!B,$BL$ $$A$e*8 $M1D$ D$$$A_F?$_$<$1$ $ $-$ 1$ D$ D$E1҉|$$1 D$ $: $@@1D$$<$@|$$`$@<$@,$@{$w@u$[@4$,$$4$  $$ x$U7$?2,$E$?t 4$D$m f$?\ 4$D$mD$$&$O?11ۅD$$u$.?k4$h$D$?L$ ${É$$d|$$1 L$D$ $bá\ $#$> D$$$$ $ kÉ$A$)$wD$4$1g$D$ > T$ $=P}T$$= L$ T$ I }T$L$$=L$D$$L$T$L$ $K=T$rT$$=T$l$ 1ۉT$,$D$$ T$|$$1D$ D$4$D$z1ҋL$D$ $< 4$D$jt`4$92$D$$L$u\ $L$ 11D$ S$*<, 4$D$Ij  t&  S  hbD$$S$T$=T$T$D$$T$u\p $T$=}$T$$D$G;L$ $T$D$ L$CT$$;T$|:t"ہ}$T$ p $XT$̉T$T$$ T$밉T$$:$:T$t $T$D$iT$R=}9T$<$H:T$$ T$T$=}T$1$A$1ۉD$$:L$$ $T$D$ $9 D$B$;  }$ $D$$p9|$$tTD$$$H11D$ 1ҾBFT$L$$,9D$ $D$$ T$D$ L$D$D$($D$ 8 T$(L$Z $8L$L$D$\$$g$f8L$mwL$$>8 T$ L$Z $7L$L$D$\$$Yg$D$$7L$|$$|}|$$T$ L$$D$($vD$$ |$$1D$ L$D$4$D$11D$ L$_D$$xL$<$ 7 T$ L$Z$6D$$1ɅL$$6L$$]11L$(] $ $l$(D$ D$ $]l$D$1D$ RL$$@6L$cGL$$6L$1D$$$5L$*L$$5 T$(L$Z$5L$L$D$$JL$D$$L$$N5L$|$$$]]~L$ $$T$ D$(D$ $]T$D$B1D$ L$$4L$4$4L$PL$$4L$ $11b4 f?D$?D$$$軿1 D$ (1&D$(D$,D$$$31= _D$ uJ1ɋl$(L$,$@L$ $3v1L$݉4$ӿL$_,$r3 T$$l$$z }$*3D$|$$b<$D$43|$4cD$4W$2 (z8>$2:1;= <$D$0~2|$0X$g2 (j8y<G$'2  |$>D$> fD$T$8<,$1hBT$<$1  T$|$>D$> fD$T$8<,$v1h8<$P1 l$$D$`,$D$+1D$0$1L$D$0T$4L$$0L$|$0T511,$01D$4<$0|$4L$4 $~011ɾT$[0 |$$D$_<$D$060|$0D$0T$0$01D$0<$/  8;$/  8T$4$/<$r/1;- ,$L$O/l$0,$C/L$1D$06 $t& /1 Mt&fv{$D$ . T$ Z }$z.D$\$$]$D$V.L$T$ L$$D$$D$D$ $- T$ L$Z $-L$L$D$\$$]$D$(-L$|$(Y|$(dL$$\- L$Z $-L$L$D$\$${\$D$$,L$|$$M|$$XL$(L$<$袹D$ $薹D$$ RL$$, T$ L$Z$;,L$L$D$$L$L$$ ,L$$bb>$+<$S$GD$ D$ D$$bD$1ҋL$D$ D$$T$(L$$j+ L$Z$)+D$$1ɅL$$+L$,$ 1۾ 7L$ $[l$ ,$O|$1D$ l$$ 1D$ L$$*L$mf1^9L$$d*L$@9L$$:*L$1D$$$*L$0$*1ɃL$$)L$$) 4$D$WD$$$)1u$})4$践$D$V)L$ $ʵÉ$苿$賵$$1ҋL$ D$ #É$G$ʵ 11D$ 1D$114$1D$ D$$C$( 4$D$V4$D$ $D$ϴ$ǴT$$軴1ҋL$ D$ ;D$(L$$' T$ L$Z$'L$L$D$${L$D$$L$$'L$|$$$ 诳<$׳<$ϳL$ |$D$ $ L$zL$(1D$ 4L$$'L$]4L$$&L$1D$($&L$3$D$&.t!$&L$4$輲D$$D$G&L$ $軲$賲T$$觲2 É$$膲1ҋL$D$ D$$[L$$%L$R$%'ft$%6v4$̱'á| $<$D$$W%L$$ $˱8 $辱$趱GL$ؼD$ $lD$ $蠲$D$,%T$  L$T$(T$ Z $$L$L$D$\$$T$D$$$L$|$$||$$V$[$ L$(Z$$D$\$$S$D$#T$$$#L$v1҅…KL$T$nÉ$$ T$$ 4v}҉g|$.D$. fD$,l$,\$(l$.T$(,<Gtp8}GG ;5 -}$`C҉Qm;5 Q1;58 Åv;5 j;5 t;5 ^=8 $aף t&$p<1[^_]Í} u $;v$ar*<$|$.D$. fD$,l$,\$(l$.T$(,<G$& 1t&$hv$X  3f=8 $`膢 |$> fT$|$8T$4;zT$T$4}#|$>T$> fT$|$4}҉2}t$,${  l$0|$0 }҉ }tAL1[^_]Í&, Et&4$  >t&4$L1[^_]Í4$  $@ [S    } ɉ J  J} ɉ JJ  } ɉ tr \ ) =}҉t( 1 H [Ív$H΍$ |$  $  &UWVS< T$Pl$T YP}҉nD$\$$  GL$(} T$P L$,ʋ \$[ } t$,ɉNL$,JL$qP}JL$,L$,ɉJ$1}YiT$(GQq  T$T$$$igD$; T$$Ƌ<4$܌;GG}tD<1[^_]fq t$(Gq,t&5 t$(G$ <1[^_]Í$v$kv$ T$P4 t$&4$xv$vD$($T&,$@vT$$4$\T$$;v$HvUWVSLD$`D$<D$8=}B|$T$ fT$l$\$l$\$҉؋ 4 Y}҉ D$ \$$Q}p 0 Y}҉$.Z t$$igD$Ë$蓉D$<=}҉GD$8=}҉3}BL1[^_]Á}? 0 Y}҉dD$ \$$} 0 Y}҉HD$8=}҉ 0 D$8qt$8}҉$+Z}L$8JT$8}-D$8}D$<=}҉|D$8$igD$ D$D$P;5 -  t$$ D$&} L$X}D$\$$ʜ= x =  D$4  }T$BB3}",X}D$\$$E4$ű$}    $D$\${$[T$=  T;4$ .$ \C$U6D$$D[&1ۃÃt:rt BBt}}tLD$,[^_]Ív<$谭v4$蠭v$萭v4$耭S<$sD$,[^_]É$_vD$ D$$D$D$$t&UWVS,D$\t&D$ |$$`Ë;|$}T$xD$ |$$D$z|$&x}'|$D$ fD$l$\$l$|$D$FFtf<$L}l$4x1ۃ ÅV,$X됍1 D$|$#tB|$D$T$|$t BBtv}tG,[^_]É<$v$谪v<$蠪yv$萪$胪,[^_]ËD$$myD$ D$$D$ D$$D$U1WVS,(}҉tkƋ<X}D$\$$uAW҉WuD$4$苩D$zfD$$tD$냍t[v~-8 $I}t ,[^_]f$,[^_]Í$LI뱍v'UWV1S,D$OD$l$$HNj7-}hMD$l$$Ƌ h}'|$D$ fD$l$\$l$l$D$CC,$H}D$D$T$\$h<}}D$,[^_]Ít&trt&T$$账&<$蠦 v,$萦v,$耦iv4$p <$cD$,[^_]É4$OD$D$$D$D$$gt&U1W1V1S,D$T$T$}P'}v1ҁ…}b  1,PT$T$D$$T$ƋzHL$L$D$$L$‹tT$ $DT$} D$T$T$$z5T$EX}'|$D$ fD$l$\$l$\$}  tk}Jtf11҉n T$$CT$}- 1Ҿ~  $)C BT$D$T$ vT$,$BT$t&,t&$hv,$XT$&4jt&4$v$}v4$vT$4$T$v$B&1ҁ?fE<$謗D$ EEtf,1[^_]Ít&$p^v$`yvT$ $LT$vT$$AT$&<$,1[^_]D$D$$ D$D$$_]&UWVS,\$@|$D}B|$D$ fD$l$\$l$t$$BBB B$t$hËtati4FF0}t,1[^_]Í$,1[^_]Í4$xu  44$/zË$4FZ  z Jt~ l$$igD$=Ët>$HFF<$荞$谞Bv,$蠞븍$萞uv4$耞WVS$v$v1Q$$> <t$  \ <8 qT}҉ }<t$BTZT=}҉}t1[^_Í$1[^_Í&D$ t$$x64$蹜t&$訜v$蘜OvUWVSL|$`}LD$`T$`|$>D$> fD$\$8\$`޿1D$(D$,D$`D$4t&L$,T$,T$0p}$ BBB B}c |$4$Ë  T$0x}'|$>D$> fD$|$8<$d}  , R } ɉ ) $T$$D$T$$}   )Z{(}'|$>\$> f\$|$8҉ ) Y}҉ }}  ,4}}}|$D$t$D$ D$D$$hǡ ,E}=}҉S ,T$d <t$9  <tT$$$T$$ BB=}҉D$` <t$  <tT$$$iT$$ B B =}҉} ( Y(}҉}? ( q }҉T} |$>D$> fD$D$80}$@$T<$L)'}~ ( q(}҉3 i|$>D$> fD$D$88} <t$ (U<t$}UBB=}҉$5b|$,}T$0BB|$(}T$(,@=D$(}L$(D$$L$ztzͷD$,} 4$˓ <t$!  <tT$$$T$$ BB= <t$ 8<t$qB B =}҉} L$4 q$}҉0D$t$$xr <t$ (U<t$RU D B8J8=҉$芑t&T$$$tT$$v<$0 $S8t&t& <t$i (U<t$:UL$`B8J8=$舐v$xv$hv$Xv$H  :&$(v$v$vL$, $^&$qv<$Џv$sv$谏vE<$謅EE;|$(}T$(L}}L1[^_]É4$vv4$dv$(v$Pv4$Ўv$v$谎v$蠎Ov$萎v4$耎uv$p v4$`L1[^_]Í<$Hv$8vL$` $$&$t&'UWVSL$T$`X}'|$>D$> fD$\$8  L$4<|$</pwMl$(L$,}%|$>l$> fL$GL$(l$ILuL$0}%|$>|$> fL$l$EL$(D$yTp} pl$uPt11$|$,g8 $,  _1ۋT$`}}}}L1[^_]f  <t$  \ (4t$(2 jT Q҉T$4 RT rɉ | T$T$$l$$DT$$}}L$(<t$L$(BTrT=҉$t&<$L1[^_]Í$Y1:*t&$؉ L$44,t$4l$($蘉 t$40, l$pL$(/$Xv$H v$8 <|$fD$0$T)|$0~褬ÃBT$$$~T$$}p} D$4$.v ɉ T$$$ST$$jf Q҉$ 4$v4$v,$v B&$t&軇)4$讇T$$t&VS\ ;    \  q$}҉D$t$$[gx $8'蓪É$|}p} D$4$tP}t#1[^Ív$&G&4$ 1[^É$릍$v$X<&\ $o^f4$Ѕv $,$&'UWVSl$$}B|$^D$^ fD$\l$\\$Xl$^\$X[ߡ J  i}'|$^L$^ fL$\l$\\$Xl$^l$X҉ ,$D$ ,$D$ <t$ (݋U<t$UBB=}҉N <t$w (݋U<t$FU$B0J0=}҉ <t$ <t$B8r8=}҉/l[^_]Ðt&$v0 ,$D$'  <,|$T|$Hy(l$<L$L})|$^|$^ fL$\l$\\$Xl$^|$X,l$P- ,ll$,}%|$^l$^ fL$\l$\\$,l$^L$ <$\$it&$j,1[^_]Í$jdvf} D$$= $Xjv <$\$k4$(j$j$j 1D$$~  \$$^X4$i6t&'UWVSLT$`@= },|$:D$: fD$8l$8\$tBB   Y L ҉yD$\$$JDO}   q}҉9 N 1ۃÅ |$(}T$(    q}҉U1D$(T$(t$|$( D$( D$,D$$v$xbv<$hb%v <$OL$0t$,$0bnv D$$c<$b"vt$ D$4 @=D$ }#|$:D$: fD$8l$8\$ l$:$ӬBBB BB B }L$ l$ $}Njl$|$   D$$> <t$O  Ё|$$D$}L$$E  i}҉gl$$|$$} T$$L$<t$kL$L$$BJ=}҉ $蜹D$ $R$ $V|$$}T$$     ,D$$l$C  L$`}FF } |$,}T$, } |$(}!L$(u $K^L1[^_]Ð;$-؁ËFFe 4D$4D$\$$x$]t&$]v,$h]v $l$a 1 T|$|$$}T$$   j } ɉ 1D$$L$$1|$,}T$, = UD$,D$4|$ |$ $D$ $N$j $- |$$}T$$    j8 } ɉ a1;- D$$L$$|$$}D$$ $Q&$[ v$WL $f $Zvt&D$l$$8D$$x_,$wZRf$hZf3똉$t&KZD$t$$跏w^4$YQv$Y f$Y6v<$Ynv|$ vt#|$$T$ $ L|$$Z $ $r$< $9Y $#YpD$t$$薎tsi <t$$  \ 40 ITL$,}҉   =$)k)щL$D=kT$,|$$T$oD$$}_|$$} L$$<t$ L$$BTJT=҉$DW$7WD$l$$誌D$$t|$$5D$$+|$,}T$,r   =$)k)щL$躑=r#-X l$,T$,1|$,fD$,$ VQ|$$v}!L$$u $U T$4T$с@^T$ l$4l$0$T$4, ɉ\ y <t$茖 |$08<t$ZBB=y <t$ ‹|$0:<t$‹B$r$=}҉} L$0 <Bl$0<*T$\} ɉ T$0 ɉT$\,)ЉD$\D$$|$D$\D$D$\$dUT$\  <t$虔 T$\L$0҉ <t$C ‹\$0<t$‹B( 9T|=}D$$1 9|=}D$$ 9|=}D$$^T 9 |=}D$$.t@/~ 9R 11$%&D$$15 1}}x}t1\$Lt$P|$Tl$X\Ðt&<$X%ۍD$$4Pf$$jv4$%{vD$$t&5 t& uTt 11t&, uO$8 1 1$ t&58 t-t Gƍ,x}D$|$$X}dEP<  G|$>D$> fD$D$8 @L$}OɉOz}P҉P"1ҁi;  8  $8 ,    NT$@ E@=T  B,|$>|$> fL$|$8M<,E=}JɉJE@= }%|$>D$> fD$}= 15 1 $~58  $8 E4$C aLD$$! =,8,E1HT$0<$ T$0<$1=yD$0$ D$0<$ v<$s v15 1$T M߿vUW1VS,Cá  h}'|$D$ fD$l$\$l$l$u2}T$$T$B$軵3C}F4$t&ft&t&t&*Vof/u T$$qT$B$A|2&x}D$݉<$$&,$vT$<$T$5vx}D$݉<$>t&T$GAT$}BBB=}'|$D$ fD$l$\$l$D$===t\=tP=tNu=ur}4$80 $fD$$Gu  ݃$ z}D$<$D$1$k0$161L0$1"-0$t&^$11/Q=&t&t&t&tPf ݃$JD$1$~Z/T$BT$p ݃$o0c$PD$1( ݃$$ {.vT$$"蛺.  T$<t$eT$  5    0><t#T$$VeT$  0F<t#T$$dT$  0F@N@=}% ɉ uT$$T$}BBu$,1[^_]à 11   ÐUWVSLt$`D$<D$8I1D$8D$ =D$8l$<$9D$,$D$8D$Q D$8=}҉u 1l$<҉T$8 &T$  $҉ T$<D$D$,$T$_#D$9|$8q =}҉y$ lt&1ۃÅtd 1ҁ…tI   tAAu$& ;5 , ;5H t\} W 1ہÅt fD$8=}҉ X =)‰ЉT$8@xD$,D$,$&D$8=l$8,$D$8}҉ D$D$8D$$}u D$<=}҉ }X } u $vD$8L[^_]Ít&t4$É$t$$D$8D$t|$84$D$8}҉= D$D$8D$$et } D$<=҉$ t$$D$H=t\}1ہÅt rffjQ<$Dt&4$=vOD$8=N҉5$j(t&D$8D$<=}҉$\]-BL$8JD$<*vX D$t$$ G=D$8Y$D$8&D$8D$\$$ 4$D$t$$FM+-H @xl$,D$,$~Ł} N }W  D$8=}҉ h |$8$[B}Z}r L$8}-JD$8} } D$<=}҉A 4$ff+- @xl$,D$,$|ŁZ}u <$f$ ZB}ZY -r }҉T$<} ɉ T$8} ɉ |v҉]D$$ D$Ht&$pvD$$ D$ivt҉=}҉WD$8=}҉#D$4$@ D$l$$8>D$l$$>$SljD$R<$D$l$$6>$SƉD$}6D$|$$8=u<$hD$l$$=$SD$D$MT$ljD$8gN$|$8=D$l$$8%=D$<$D$|$*l$,D$,  D$*fD$&l$&l$* $D$* fD$(l$(\$,l$*|$,|$8|$*l$,D$, D$*fD$&l$&l$* D$* fD$(l$(\$,l$*|$,ND$,$D$:D$4$D$$$t<$sv$cv<$SvZ,$Cvk4$3v$sƐ6$sljD$8$s1Í'UWVS DŽ$DŽ$$k4$_\$D$D$t$ |$t$ 6L$t ˉ p 4?$x$ۄ$$rá ҉$3W11D$|D$@D$LD$XD$PT$@GD$<}BD ؍K-?L$(xD$($rD$(}p}|$( T$(p  p 0Q ف?sx$ۄ$$pqƁ|$(}T$(Ch } 5t a t  ف?C x$ۄ$$p}҉j}= t  t  1=}҉-r}-\j }D$l$$},h$}$PMAAA },T$T$,$6T$Ƌep<Q mO6 @<=14x3?1FOr?x$ۄ$$nƁ}4$輮|$PD$h}T$P3}53@<=042|$hY0L$h1Ή p ?x$ۄ$$mƁ}2h<}/5p G-p (Mف?CE$ۄ$$Mm=$ټ$|$h$ f$٬$|$(٬$T$(p L$h=ټ$$ f$٬$|$(٬$L$( h@ 1@@=b0,?P},$w|$|D$(}!T$|u$}u,$ch@}|$(ML$( p \Mp ()P-?k,M$ۄ$$kŁMټ$$ f$٬$|$0٬$T$0p |$(LL$( Z|$h£p L$h= G҉.$G!f'-?k x$ۄ$$jŋp}u -t  t m'ف?sx$ۄ$$5jƁ}_KB$=D$(} 5p |$( p L$(R ,JED$X=}҉t[$L}U&Gf}hIh$h D$ l$$0Ƌ I3 |$L}T$L+$ ؉p h,$ED$L-+D$L$$D$$D$L$PL$h/4ځ@x$ۄ$$gÃD$@L$@9$ |$<}GGL$h L$P ټ$$ f$t ٬$ߜ$٬$$ ҉D$$,$sD$$zټ$$ f$٬$߼$٬$$t zټ$$ f$t ٬$ߜ$٬$$L3,$+ $f4ټ$$ f$٬$߼$٬$$t mټ$$ f$p ٬$߼$٬$$4$ $-eL$(ټ$$ f$٬$߼$٬$$p * $dD$( $dt҉t$D$$D$$ &|5t 5t }ټ$5t $ f$٬$ߜ$٬$$5t vT$|1L$PT$(L$h}sDT$(T$| ؍K-?L$0xD$0$scD$0}tCpD}|$0T$0p Qp 0@ ؍K -?L$(xD$($bD$(|$0}T$00DpH}|$(L$( p =p 0؍K$-?L$0xD$0$SbD$0|$(}T$(CpP}|$0%L$0 p p 0ف?s0x$ۄ$$aƁ|$0}T$0Bhd}5p bp (Xp  <ټ$$ f$٬$|$0٬$T$0Ph}u-p rGL$P1L$h|$L}T$LY%h D$l$$s(D$L%|$LL$L=| t  t =}=ټ$ t $ f$٬$ߜ$٬$$ t yE1D$Ll$LD$PD$hm,$^D$L-ټ$$ f$٬$|$(٬$D$(p T$<$ym$l4$_ ,$Rf$vD$$4$/D$$,C 1ټ$$ f$t ٬$ߜ$٬$$4$ټ$$ f$٬$߼$٬$$t K|$(D$(|$(ټ$$ f$p ٬$|$0٬$L$0L$({ $lټ$$ f$٬$|$0٬$D$0p Nټ$$ f$p ٬$߼$٬$$ټ$$ f$٬$߼$٬$$p 1ټ$$ f$p ٬$߼$٬$$4$UD$0ټ$$ f$٬$߼$٬$$p D$(ټ$$ f$٬$߼$٬$$p (ټ$$ f$p ٬$߼$٬$$oV4$9I2ټ$$ f$p ٬$߼$٬$$[B4$5L$0ټ$$ f$٬$߼$٬$$p |$XD$L$f$$$D$p@|$pUT$pt $f=| t  t =}=tPټ$ t $ f$٬$ߜ$٬$$ t 뀡 $$| ?$Q;}<$$$9$}$$|$t} T$t$ $Ε$$<$ L$t$$T$0oL$p$T$tD$pL$L\$X׉D$PD$(\$@t$`f|$<}T$< L$(CD$<w4?x$ۄ$$lWƁ}Cxv?F Q$ۄ$$V=0ټ$$ f$٬$߼$٬$$=p |$0T$0=}҉7x}|$0D$0t mt @=<'7|$0|$0@x$ۄ$$Uǁk=t ?|$0~D$0$UD$0h$}D$ l$$} y=?|$p %D$L$TŁ}U 5p i (D$(D$(9D$@=}҉h }D$l$$u}5K =? |$p„O D$X$S8 $S+<$-?n $ۄ$$=SŁټ$$ f$٬$߼$٬$$Љp $C$D$(D$(9D$@4$\$@t$`  $ ,$ | <1ҽАt&}҉T |    =}Wټ$$ f$٬$ۜ$٬$$҉1 ȃ9C$D$T$Z?ىT$(439$ۄ$  $L$ GQL$ $},$Q$D$x,$?44,$bT$xl$D$$\|$x/L$xD$(T$0 p $ \$xL$x?x$ۄ$$wPÉ,$| ҉T$l D$dt&} | L$dT$d< |$<}L$<-| =D$<# @xD$PD$XD$XD$L)D$LT$L+D$XD$@T$0D$`t&$=p =p =}҉0ٍC?$x$ۄ$$N$}T$`<}$=}<ټ$$ f$٬$߼$٬$$t t T$X@}z tAAZjD$'l$$$SD$D$BT$}*}1d o8}}4$=}҉H$?L$ L$D$'$GsL$ ʼn$l$|$$ -$}}p $=p =}҉ٍC?$x$ۄ$$K$}Jx}$=}<ټ$$ f$٬$߼$٬$$t t ف@x$ۄ$$JÁ}$=}҉HT$0<$t|$D$$ ,$҉t=}~t4$'‰T$C $"C{4$v,$sv*,$cv $B$7n $BD$( $BD$0p  At&ټ$$ f$٬$|$(٬$T$(Ph}u-p p  <ټ$$ f$٬$|$0٬$T$0Ph}u-p p  t$0@t&ټ$$ f$٬$|$(٬$T$(Pp}ut$0p +p  ?vټ$$ f$٬$|$(٬$T$(Ph}u-p ټ$$ f$٬$߼$٬$$=?K1҉$$߬$$G@%Dp  l$0<ټ$$ f$٬$|$(٬$T$(Ph}ul$0p ',$v=| t  t =}=ټ$ t $ f$٬$ߜ$٬$$ t yD$(t$`,p <ټ$$ f$٬$|$0٬$L$0HMp}ut$`p $t&=| t  t =}=ټ$ t $ f$٬$ߜ$٬$$ t yټ$$ f$٬$߼$٬$$p  D$hټ$$ f$D$h٬$߼$٬$$ 2p $R=p4%4?R$ۄ$  $=6$qq,$cvD$tټ$$ f$ ٬$߼$٬$$$ D$t p $v<á $L$pټ$$ f$٬$߼$٬$$t k,$eټ$$ f$p ٬$߼$٬$$$D$(,$E$u$v$v,$v,$v$v4$sv,$cvZ,$Sv!vfn ?$$,ټ$$ f$t ٬$ߜ$٬$$& p >fټ$$ f$٬$|$(٬$T$(Ph}u-p $t& $9t҉t t&$@ $k9 t&( $K9$t&P;fvfh )|$D$$ t7 d ټ$$ f$٬$ۜ$٬$$8Et&tټ$$ f$t ٬$ߜ$٬$$v p C&ټ$$ f$٬$|$(٬$T$(Ph}u-p $Jf=| t  t =}=ټ$ t $ f$٬$ߜ$٬$$ t y$ۄ$$6$ $ v<$v<$v$L$PD$@9L$@t&t$LD$dD$d9D$l|$P|  $ |  D$ D$$$ D$$D$$$l$$M$D$0$\$(1v9$}$4u$띐t&4$v$v<$xtv, $4$d&$@v=| t  t =}=ټ$ t $ f$٬$ߜ$٬$$ t y=ټ$$ f$p ٬$|$(٬$L$( fټ$$ f$٬$߼$٬$$p fS@$x$ۄ$$g3$VvCh )i')͉$v<$v<$xv$h;v|$<}L$<~| D=D$<}l$(LEl$0HKT$L$L$ D$$ YL$ T$NjG}}t*T$,$T$L$<D$0L$(D$0Ay=} ɉ | =D$P}2ټ$$ f$٬$\$P٬$} L$PT$(ɋBD$Xټ$$ۄ$ 0 $f$٬$٬$ $ f$٬$ۜ$٬$$ $$U,$ $,$v<$v,$v1<$El$0H@T$L$L$ D$$ L$ T$Nj}}t*T$,$ T$L$<D$0L$(D$0Ay=l$<ED$<T$<$T$k4$<$<$y?$ۄ$T$$/T$Cy?$ۄ$T$$.T$\$0\$(4$+$4 ?}4$n$D$(|$( T$(| p 4$D$(L$(?z $ۄ$$.=Y ټ$$ f$٬$߼$٬$$։p  $0|$(cD$(T$(?l $ۄ$$u-=K ټ$$ f$٬$߼$٬$$։p t $|$(D$(T$( ? $ۄ$$,= ټ$$ f$٬$߼$٬$$։p  $|$(D$(T$(? $ۄ$$A,= ټ$$ f$٬$߼$٬$$։p T $b|$(D$(T$(? $ۄ$$+= ټ$$ f$٬$|$@٬$T$@p $|$(#t$(D$(-? $$ $$5p |$(D$(T$(?$x$ۄ$$*$4$. 4$=p 0D$0$j$$D$0T$(L$(\$`T$XT$( L$@D$@\$P?T$L$=}҉|$( D$@$D$LxD$P$)$}!C{9a$=f$ۄ$$J)}҉=E£p 2=}҉`$,<5t =| t  t =}=tPټ$ t $ f$٬$ߜ$٬$$ t 뀋1$(<,>-@x$ۄ$$'Łnu?-t E~$ۄ$$'ƍ&9\$0[\$`$|$t‹} L$tL$t|$xH} L$xL$x|$(H} L$(L$(|$pH } L$pL$pH<$Zl$$A:@$BD$t$6$*$$$L$( $$$D$x$߾$ӾT$p$Ǿ4$迾$ $谾D$h$褾T$|$蘾$ $艾$}$$n$$_D$<$S$=}҉u$|$0}!T$0u$Է|$l}!L$lu $詷ļ1[^_]É$ۄ$  $%$ۄ$$$=ټ$$ f$٬$߼$٬$$=p ~ټ$$ f$٬$߼$٬$$:=ټ$$ f$٬$߼$٬$$t l$D$$ \C,$+6ټ$$ f$٬$߼$٬$$t @6$ۄ$$I#$ۄ$$'#Y@4$h3$[<$ND$X $"$$"TD$$<$D$$`$<$v$Ӵvj$ôvT$ $说T$mT$ $蚴T$bT$$腴T$Bټ$$ f$٬$߼$٬$$Љp 8£p Wƣp ƣp D$(ټ$$ f$٬$߼$٬$$p | 4$ɹD$( $0!ƣp ƣp $ !D$xL$0ټ$$ f$٬$߼$٬$$Љp T$( $*D$x $ $ۄ$$t Ƌ$$ $8ټ$$ f$٬$|$@٬$D$@p T$ $hT$T$ $ST$4$Bf},$3v4$#v鈶4$v郰 $4 T$$hT$$襱錰,$蘱D$(D$|逻$胱dD$(ټ$$ f$٬$|$0٬$D$0 $5$(X,$锴$ $c$v,$vZ-p '9ټ$$ f$p ٬$߼$٬$$P7,$R*D$(ټ$$ f$٬$߼$٬$$p ͱ$ۄ$$}  $ۄ$$NT$T$(L$( $&T$( $,$i:L$( $/L$( $$$ۄ$  $L$( $u/L$($ $Ww  $=L$ۄ$$ p  <ټ$$ f$٬$|$0٬$T$0PPT$0}uL$0 p $ۄ$  $ $i1D$L1D$<D$|D$hBT$D$D$$ T$L$L$ D$'$GL$ ʼn$nD$ D$$ձT$D$D$$ T$D$D$$eD$L|$D$$ D$ UWVS,D$@l$@D$4<F0 $D$҉D$t^u5~cE8\$|0 $D$5D$tˋT$@D$  t$D$$/f$D$fD D$.D$D$$軷T$@u$zD$,[^_]Í&'UWVSL=< D$<D$8D$4 @ =D$<T$<1ۋ D$8 1t&9t$8}MD$<<}D$.\$$Ȋt}D$<<80 <$D$`Ë!9t$8T$<@T$&  p  ;$  J T J -D$J D$<D$ $ D$} D$|$1l$4\$fD$4҉D$4D$D$<,$D$ִD$4 T$$w9t$jD$8=}҉6 D$8D$4=}҉D$4D$D$<,$D$L$4 <t$KL$4 T$8 ҉$舧v0 <$D$c$`v$Pv<$@6v D$8D$D$(8 D$,\ D$0D$(D$D$8$YD$8D$$}E   d D$$DE D$$'E D$$ E D$$DD$<=}҉E $1+t$}X $D$.0T$<|$<f 4$D$҉D$8R=}҉ZD$<=  D$$T$8T$^}D$<4teL$8ځ}҉VT$84t$8 4$D$D$8D$8< =}҉ RT$8}҉$\L$8JL$8}L$<-JT$<  A =} ɉ D$8 = ɉ $苢T$ 9r*  vۉ$+9s[^_]= :B  [^_]Ðt&[^_]Ðt& [^-_]JB [^_]Ít&2 & $E8 $- &UWVS$D$,f$h 謔t&9\$,|z,}W` Ew$ vT1 t k4H T1 t k4H D 9\$,}ļ[^_]Ðt&D]t&T1 t k4H T1 t k4H T 1 t k4H T1 t k4H t&D뢍vDŃD$4~2H D$0Dt&81Ʌtk4L$09}D$4\T1 t k4H iC1ҍ D$8k4-H D$4D$D$0~4|$0D1҉\$<1Ʌtk4L 9u\$<-H D$4||D$01ɃÍtk4L \$8 t&T1 t k4H T1 t k4H T 1 t k4H T1 t k4H T1 t k4H DBfT1 t k4H DT1 t k4H T1 t k4H fT1 t k4H T1 t k4H T 1 t k4H vl~+H 1҉D$0D81Ʌtk4L$09uD1 \7&T1 t k4H T 1 t k4H T1 t k4H vD$,T$(|$ \$D$D$LD$ $<D$L$TT$(vk4H @fk4H \|t&D$0jfS(=}]=|>|$L$ fL$l$\$l$L$RY9s=ȃ([Í$ 贏1Ƀ([ÍvR$T$41Ƀ([ÉT$$1Ƀ([Ít&'S(=}U=|>|$L$ fL$l$\$l$L$RY9s5ȃ([Ík1Ƀ([fR$T$1Ƀ([ÉT$$1Ƀ([ÍvSD$ \$$4 $8 T, 4 h DD   [WVS\$ s(D 9tiC0 $'0S,PSC,҉t z ~ y t&1I0uK t1I0uD vSK,;tc΋I9uyA~u02Rtz ~S tt&02Ru $bD C([^_ËqAs,몐&UWVS$0S 8 D$PD$Lt&kUCkS0=} ɉ :HE2[2Ek S D$P, ;  8 ACk$z D$);$ A  D$@C8D$Pf2T$@D$Pz-T2L$@A$9tF tū T$T$@L$D$ B D$ $ D$$ L$@<Q(iA0T$, $T$,L$@Q,PA,fMUm}uՅ{ u t&UEmt} ~L$@Q t= Ru&fEm=}=uߍ{ T$@D B(, P8, jUC=D$`}, @@D$LKiL$@uRfEmtB} =}҉Ik7UC8&)SC2<P;I>S k0/=0>2UHC8C 0V/C<,t ,$8 tS CP;U <}k7=-SC{ C=68 kD$T$$Ƌ7=}҉RUVC{ C=K68 kD$T$$ 衮Ƌ7=}҉QUSk CS C{7=} 7Nk S C1ɋ8C֋(}U<4t"4$L$08 L$0-E;F;<>?-8 $$8 D$|D$|$qƋk7=+S{@C0C(Ck8   C D$CD$$蟧Ss뿋C Ck8 D$C D$C$ES;C{}=} ɉ HqC {C0{4=}҉fES k 7)&C8 =2*$` ƋCk} ɉ [*k S 06P럺Q똺Rv뎺I뇺Jf{3qC0{@Ck} ɉ ?Gk S 0C{0>k 7d;S C{0,>8 HLL$0k r1ҋL$0r7f9S ,CS{ 2=D$@18  88$$t$D$|$D$|ݜ$$dƋk7=Z7SCS { 0C0-@~5t$|D$|$T$,8 T$,Ɖ$T$,jR7S"CkS8=SC=-Ck} ɉ Ik S 0Ck8C} ɉ Bk S 0oCk8C} ɉ Ak S 0(Ck} ɉ  Ak S C0݉8 $$ Ck0?>56UfkS~Ck8IG` SUCk85GS9k\$@8 ,$AT$d8D$\ׅ~AL$@&=}9}ދL$dL$@)T$@} ɉ AT$\l$@D$@P|8 $芻8ŋC=G}C=G}C S T$\}҉4@kSCk8   C D$CD$C$ӟSC<4t 4$8 S CP;V 9k<E>7+SGC 0}S<,t",$8 |SŋCP;U8 { C7;0[.kSCk 8 D$C$萡ƋC } ɉ ?kS0YC8 0}3()|$zD$z fD$xl$x|$pl$zD$pɋ0"@DCk} ɉ hAk S 0KS C{ 1+0-@.t$|D$|$T$,8 T$,Ɖ$T$,jR7cCk 8 D$C$d S :8 _-8 Us=}҉<kD d@ kD$_SCk8 $]S8 HkƋE=}҉<ukSpC8 $kƋE=}҉<uk S %kCD$8 l$Dl $/rUCk8 $ƋC} ɉ <k S 0Cs} ɉ <kSi= 8 t诽$i]7Ck} ɉ <kS0= 8 kt -8 C购UCk 8 D$C$KS -8 D$HCk L$H8 0L$t$C$<S rC k8 D$CD$C$zS@D$H듋Ck 8 D$C$igD$?ƋC } ɉ 19kS08 kPƋC} ɉ :kS0Ck8 $ƋC} ɉ +9k S 0FCk 8 D$C$ƋC } ɉ 8kS0Ck 8 D$C$S C{ 0C90$kSC{ C=|$8 kD$T$$Ƌ7=}҉JAUBKSC{ 1&t$T$,8 D$$舝T$,ƅ j R C{ 0C902&kSC{ C=#8 kD$T$$ Ƌ7=}҉4@U\KSC{ 1h#t$T$,8 D$$袜T$,SC{ 2903kSC{ C=|$8 kD$T$$BƋ7=}҉*?UKSC{ 1#t$T$,8 D$$؛T$,C{ 0C90#kS-C{ C=&8 kD$T$$xƋ7=}҉>UKSC{ 1d&t$T$,8 D$$T$,7C{ 0C90%kScC{ C=F$8 kD$T$$讚Ƌ7=}҉=UC0#&&Ck} ɉ >k UC0"&&k UWC0098C k } ɉ 8kS0C0/C k } ɉ D9kS0C(C0#l$8 t$$$SD$D$,IT$,##$.cz#C{ C="8 kD$T$$胘Ƌ7=}҉;UKSC{ 1"t$T$,8 D$$T$,BSC{ 290/pC{ C=0"8 kD$T$$軗Ƌ7=}҉:U KSC{ 1!!t$T$,8 D$$QT$,zC{ 0C=\!t$k8 D$$8Ƌ7=}҉9UaC{ 0C=t$k8 D$$謖Ƌ7=}҉D9UC{ 0C=xt$k8 D$$GƋ7=}҉8UC{ C=8 kD$T$$HƋ7=}҉u$(`U.C{ C(l$k8 L$$xƋ7=}҉@8UC{ C0t$k8 L$$GƋ7=}҉7UbCS{ =D$@8 !|$@!$$T$D$|$D$|ݜ$$,Ck 0:'?2E=G'ukSCkS 0*?32UkCڋ0~k S SCڋ0JjU7C07 0 Ck} ɉ 7k UC Ss$ S4$D$T$ST$\ŋC}҉%-(kSjC(C0&8 }l$kt$C $gSCC0&8 }T$kt$C $=} ɉ 2U-8 $qJUe<t $x X@$ D$‰D$XT$,@$ D$ٹT$,r#T$,,$T$,D$@8D$Hx1 L9u)D$HU"8 臋kS8 okS8 WkS˾8 ?kS鳾E$U鞾E$U鉾=|T$kD$$ rƋ7=҉$=U ||$@^5t$D$$ lr3=||$@~t$D$$ 5r$Ƨ JB1D   }u4$Q<kSTL$08 L$08 Y ɉ 2U҉ -8 $;U U魼kU頼 $Uf1{ =҉-8 $;U ҉-8 $:UkS҉-8 $:U҉-8 $z:U}҉-8 $K:U}DkS% U҉-8 $9U҉-8 $9U o $$D$|D$|t$|D$|ټ$$% f$ ٬$ ٬$ 7 |$zD$z fD$xl$x\$|l$zl$|T UkS҉)-8 $8UkS駹҉.-8 $p8U҉d-8 $A8UQkS<҉Q-8 $8U>҉-8 $7Uv҉-8 $7U 9ꐍt&5kUt$8 D$$ lƋE=}҉M ukS=L$0k 8 t$$>pL$0W> $6U1T$,k 8 t$$T$,$6U8 $m6鱷8 龷8 +8 $ D8 $ aDT$,8 $ :DT$,8 T$,k 8 t$$ T$,$5U8 誳3t$k8 $SƋCd8 g`$藏S $腏S8 k賗D$C$蓐S8 k芗C$DS8 kiWS8 7D   8 k1C$6St$8 $ډt$8 D$$i$SʼnD$l!,$3t$T$,8 D$$ FiT$,=2E$U鞴t$8 D$$iAkSlSbW  $$w4 ,$;%ƍ$$F9  2U w  vT$,\$0$ @T$,D$0|$zD$z fD$xl$x|$@l$zD$@|$zD$z fD$xl$x|$pl$zD$pD$X҉U1|$zL$XD$z fD$xl$x\$nl$zD$nASL$@1\$@t&D2x1.@yD$|D$|T$,$+T$,D2yϋt$\\$@8 T$,~T$,T$,$l ?T$,&l k 8 $"1S 7酺p 9T$H$0k7UFQ8 $0E۾$0E$0E$0E8 $0EU8 $ =1~8 $L0Eֽ8 $40L$\$0Z$0E$/E$/E$/gE$/R$/L$\鷿$/EE$/k$/E$t/Em8 $^/$O/$>/E$,/E$/E$/E4$.L$@[$.E$.E$.E]$.E-8 4$.U18 $}.$n.E鯸T$,$X.T$,^$E.L$\4$2.UD$L8 $.E$ X  A$y3( , a-8  $-U=?[=Pk=7m҉PU}T$,-8 $Y-T$,T$,-8 $<-T$,8$-8 %-U$8 $ [;z$-8 ,U E8 $,9kU$ T$,= u 4$,T$,U-8 $w,UG8 wj8 $D,E逾 U-8 $,Ul$X[t$|D$|$舙Ft$|D$|| 8 $ckSϬL$|D$|l$|D$|$5L$0$ 9L$0U8 $ 9st$|D$|T$,$8 ٘T$,T$@` ` $D h98 $+E8 $*=$*L$\OT *8 $X 9$ X  $ 8$ 8e8 $`*E?9Y9=?=fl-8 $wS-8 $wSB D$ $ D$$ 8D$P韫8 $)E8 4$)8 $z)L$\$ 71)1Wp T$,8 $赖T$,鰵t$|D$|$蚖L$0$` C7L$0音訋t&葈$$T$|$D$|ݜ$T$$裖$$$4$T$D$|D$|ݜ$詖T$,-8 $N(T$,$$$T$|$D$|ݜ$T$ҕi$ O6L$0c14$'$'$'UZ$'U$'U$'U)$z'U$j'U`$Z'U$J'UZ$:'U$*'Uc$'U鿿$ 'U $&U($&U驾?#f 4$D$t$$P$ 4T$,y$j&E4$Z&88 $E&Em8 $-&E8 $&E>8 $%E_t&D$ $豦 ÍvUWVS,H 4&<94K1t k4H CC<u͋C=t t=ustT$4$趞T$K 1st k4H s C C(C,>_m ٠ [98 Uf,[^_]Ë6T$ $aT$L < P t P\ P0 P @ Pd P P Px PL D$H T  @ $蛿Ít&'D$> $eD$_ $QD$_ $ =D$$ l X ʚ;jD 8 P(Ð         &ń (uÍv1<Մ (uÍvSL$ D$\$}~1ҍ9u[Ív'T$|$D$% fD$l$l$u? w<X w7|$D$ fD$l$$l$$&t& t&؍ЃÍv'Ív'D$#D$Í&D$ D$Í&D$3D$Í&D$É'D$9D$ÐD$D$Ív'D$9D$ÐD$D$Ív'D$9D$ÐD$D$Ív'D$9D$ÐD$D$Ív'D$9D$ÐD$D$Ív'D$9D$ÐD$D$Ív'L$T$!Ð&L$1tD$1؉Ít&'D$ D$ÐL$uD$1؉ÍvL$T$1Ð&D$D$ž11|$Ðt&D$Í&'D$Ít&'0 ; ~0 0 tB҉ tD$ $ERÐD$͝ $0R0 f  tD$ $R  uy'S0 ~ D$ $Q0   ~:t& D$ $Q 0  9}С  t[f[& X T$tH v;=$ t2=( ~)u=, P~ =0 P~T$ Mt&D$ 8&S(D$0\$4t0T$D$'\$D$'D$T$$P([ÍvX tƋ v=$ t=( ~Q$  uD$D$D$D$$,P$;KyLl$H- \$<Ét$@|$Dta=|r=gt$D$D$ 4$3 t$$O4$0 ~=$ t ~\$H[~N&'UWVS1ۃl$0|$4 t&t1D$p$b9t)ƃ[^_]Í1[^_]ÍVS=   t#X  0 uY\ uOD t/4 vA D$? $,L ${芇D$ $ʢc몐=8 Pu$4 tD$9 $u됐 1۾gfffD$ $Kt&; 9H D$ $K)9u D$l $[K $誟qut&   t&'S($D$D$$ܞ$bOK-JKJK J KJKJ JKJKJ ([Ít&',$mD$D$$]iHQiPk@<¡< ( u < u ( ,Ð&D$ $ D$$8 D$,, D$04   KOK         fń (u$uD ex.ef@rr@ u ÍX& < \$ t$|$ɉl$t=(  tq'1Ҿ'f_Or&)݅-< xii9)\$ =( t$f1҉Ջ|$% l$=(  < Ulj )Éi)ɉy@ zO)i&)iNi۳/9>ū3 zO)‰i&)y뫃&fD$ $nÍ&D$ $nÉ'D$ $knÍ&D$ $MnÉ'D$ $-nÉ'D$ $nÍt&'D$ $mÉ'D$ $mÍt&' D$=}D$ #KvD$ mWVSD$ =4<=}N=tQ҉u*=}N44<߃=|t&_w<$zJuՃ[^_Í&$躚D$ [^_餚&V1ST5 T$`` HhT$ L$Z$5 =}҉D$d$ D$$L5 =}҉D$h$ D$(5( =}҉D$l$x( D$,5 =}%҉u$5 fD$p$$ D$0h5 =}҉D$t$ D$4 5 =}҉D$x$ D$85$ =}҉D$|$L$ D$<5 =}҉t$$ D$@tI5 =}҉@$$ D$D&`  T$ D(, 8 @, D$$|8  -, t  T[^Ð $Q D$kT[^Ív$5 t&$5 !t&$5( Q$5 $z5 $g5$ D$T5 y$A5 ,D$0\$\$@t$ t$<|$$|$8=l$(l$4}҉}}}tR}t\$t$ |$$l$(,Ð\$0t$ \$|$$l$(,t&}t܍t&<1t&T}uދ|-L[^_]f ɉ u׋D$8$D$8Í&<0+ 9L$~y 9~Q))ʼny A!& }y9=} D$D$<4$D$щT$<h$,=Z}z'S \$ 2H t 3 D$[ $.8 \$$8 D$ $8D D$ $O D$ D$D$$\ 肍 \$D$ $y tK H t  ~D$ D$ $C D$ D$ $% $x D$ [t&$D$JD[ÍvD$ $6v'UWVS<|$Pl$T\$X]D$2}3|$.D$. fD$,l$,\$(l$.\$(ۋ4F9,+t$l$ D$ )ދ,t$\$$|$$l$t$1ۍvTD9tl=|U|MD$$Í$8 t4\$D$h $ 1$ IWt&D$$uu+|$ G<[^_]Í$ &$ &$ n1뭍t&'UWVS,|$Dt$@l$HD$D<}3|$D$ fD$l$\$l$l$G9T$D),v=}9,uD$4$|uЋT$D+,[^_]=tqD$4$Mtу=|9uT$D+뿍&$ tl$D$ $ 8$ Pv,1[^_]Í)名t&~ك4$D$uT$D+/&$ < VS$T$0D$4}'|$T$ fT$l$\$l$\$=}'|$D$ fD$l$\$l$t$~ ~; ~Jt$ \$D$< $ $ *= t6>t$4\$0$[^-f;5@ ~묍&',=}/=|5|$D$ fD$l$\$l$T$Ѓ,Í&$x ,Ð&VSD$\$=|=|SS[^Ðt&4t&[CS=}=u[^Í+뤍&t&,=\$Ét$ ։|$$ωl$(l$0C9"~99B\$t$ |$$l$(,f\$ t$D$4 $ m$ (9~\$ |$D$d $ l\$D$0 t$ |$$l$(,$@ Dt$D$ $ l$  |$D$ $ ll$ t&l$D$ $ D$> fD$t$8}3|$>D$> fD$l$8)x؉<$  ;<$P14;( T }uދ  ; |-L[^_]fۉu׋D$$$  D$$뽐<W L$(T$4)OL$09'T$4L$4L9ʉL$, l$(Չ\$4 f9rOU} ɉ u׋E$$ .G$ sD$,؋\$4l$(T$(T$,L$0 L$4L$()L9L$4whl$,l$4\$4F)ڍ9w-U}ދuɋE$6뼋l$,\$4D$(D$(T$0<) 3'UWVS,t$@\$DD$,D$D$D$)D$D$D$|$l$t$1ۍvTD9t,=|| D$ÍD$$$uu+|$G,[^_]Í$ T/$ <D$#$, 1릍t&UWVS,l$Dt$@<&}=}9uT$D$4$(T$uȉ+,[^_]Ít&=t1D$4$tу=|9u+뿍v,1[^_]Í< v~ك4$D$蘫u+ov$d  UWVSLt$d|$h\$`|1t-t$,D$,D$0\$0|$$d L[^_]Ít&( ` T$ $L$D$$T$<L$҉D$(D$ Ń&t&=%D$t$$E=|ӉD$4$T$$Ev` T$ ,9t(D$ l$D$ $ Sc$ k,$C,48D$(.&UT$D$$a=}=t>UА1x1t$$މːD/4$D$D$$D$T$ D*y؋D$(L[^_-]Ít&T$$T$ 낐$T$m4T$D$(D$$|pŃ=t|$D$$E=|׉|$$T$ E፴&|$,D$0D$,\$0D$4$d f1-|$ ߉Ӑt&T$ T$D.<$D$T$$D*yv|$4$d + S(\$0wM v $ f|$T$ fT$1l$|$l$L$([BÍv$1 "롍&'S\$ ~1҃[BÍv$1 fS\$ v$4[Ít&$ ׍S(\$0~\$D$$3([Ð$ l֍v'S\$ r$3[$ 2ߍ&'S(\$0x\$D$$B3([Ðt&$ ֍v',t$(t$0\$$\$4uTs;&t&\$$6`\$$t$(\$0,2$O rs|$D$% fD$l$l$ٞt$H &ut&'S(L$4T$0xtKɸt4AwJN|B:лt9}([Ð([Í&L$D$\$T$D$$_\$0([1&m$O T([  w ڞs' f؍t&$| ٞrwt&S(\$0 wA w>|$D$ fD$l$|$l$D$Љ@x"([Ðt&t&؉ډ5볐D$D$$0([Ít&'VS\$ t$$؉|$ D$ fD$l$<$l$ $l$<$l$ $1Љ@x[^ÉD$ D$ \$ [^"0fVS\$ t$$؉|$ D$ fD$l$<$l$ $l$<$l$ $ Љ@x[^ÉD$ D$ \$ [^/fVS\$ t$$؉|$ D$ fD$l$<$l$ $l$<$l$ $!Љ@x[^ÉD$ D$ \$ [^B/f\$\$$t$t$ u$ zً\$\$ t$.t&\$\$$t$t$ u $ t$\$Í\$\$$t$t$ u$ F>\$t$\$ n.&',\$$\$4t$(t$0tu%\$$t$(,$ tۉt$t$(D$\$\$$D$\$0,-WVS0|$D\$@4$d Q}R4~1f\9u0-[^_Í ZZZ ZZZZZ Z$( ؅~t&tuf|@ w^rm|$.D$. fD$,l$,\$(l$.t$(.f$ &$ &\$$k xD$\$$ bD$z'ShD$p w, \$$D$D$ X$1h[Ð D$P &UWVS D$~S@ 11$4@t&$~)L$ 1T$vf\\9uX;l$u[^_]Ð Ðt&\\$L\$`t$Pt$d|$T|$l$Xl$,\$,$D$\ Xt$<$D$\ W D$D$$\ D$ Z ,$D$W $;D$6Z <$D$W $HD$Z $X|$T5 l$X t$P\$L\Í& D$D$$_ D$ tYD$$  ÍUWVS|=  $s;= E< < @ 9}{iX v9 t&< t_@ 9~Ld ۉ݈Fh Fx9}$D$4\$D$d $1VD$4$G< tu|[^_]Ðt&T$4$T$,t$l$ |$D$x UT$,$蠪t&'WVS = fڅ -` ;@ ~   t uÍv   t L$$` D$4U $V$` ? $D$W $mVL$ b ` ` څ+f` tU tK $` D$T $U$`   ` -`   [^_Ít& ;@ ~c=  -` P)ÃӋ@  9~Z)ÅhvD 9}߉= G&= 0 ` T$$` D$S $U$` T$  ` 4  9 {t&\$\$ t$t$$igtU; ; = t u\$$\$t$ t$Rv= ސ4$Tá@ ;, ~' ( , $T T$@ ( t$$T), ( \$t$ËH A= t \$t$fL  @ tNjD 뷍CQ, P$t$@ $T( l&    VS${S$` jS$H YS5   L ~> @ 1f~)iX1 & @@9u9ũ[^ÍWVS1ۃ; }t{D$<$ @ ~MiX1 t&$1C$f1 D$C$ZS95@ Ɖ; | $ R[^_ÐS$, @BP$4 RD ex.ef@rr@$Κ P x @$ D$+R  !%tꩀtU   /tt&\t= r /u@x[f$ɚ 0P tO$oQ $Rá $D$qQ$IQ/eup@horif@a    Ot& QPt& Qt&S\$ ?~ $ $P(@X@ [WVS\$ C$ 1҉Ƌ8 D=D}=uߋCCu$![^_Ð&WVSt$ 4$ PÉ$$ۋ8~1ҍt& L9u-[^_Ív'$ Í' M  @ @( @ @~ @j @V$ @B @. @ @ Ðt x à =\ uPPh> jL<  D$ 鑬h Ãh Ãh? ÃD$p hn h QLD$ ev} _E L$T$D$ $(2T$<>t&',D$4\$$t$(=|\$$t$(,Ð<D$$ $ D$$ D$D$0D$ D$8D$t@=t t=u$ ~h  1;u bv;tK9|5, 9'tJF, D$ $£  $ P$ #  1 , $P£  $ 뵍&'VS8 D$$t$ 9uj&x  9tN@uZt*&{ ~F S $T$t0t[u1>[^Ít&[^1~ [^Í&'VSD$$t$ Xu"fC 4$D$0t[t{ ~1[^Ã[^Ð,D$0\$$ yD$@,-`Ã,D$4D$0$ \$AD$@,-`Ð&,D$4D$0$ \$D$@,-`Ð&,D$0D$4 $ \$D$@,-`ÐÍ&'1Í'Í&'Ív',=}.=|/|$D$ fD$l$\$l$D$,Ít&$ D,à D$  Í D$  'Sh \$$D$ D$ $D$*$ɞĈ[Ð$ 1Ít&'$ Ð&,T$4L$0}/|+|$D$ fD$l$|$l$D$,ÉL$D$ $ )D$0 ,WVSÃt2$8~1f L9u-[^_f$ ĝ$[^_-É'WVSà 49t $  ~1\$T9utD$$ [^_fD$$t [^_Í'S\$ } <t $L @$ D$`H @$ D$AL @ $ D$"P @$ D$$T mi8 @$h[Í&'UWVS,\$@<t $t @t+t $ @O;-$   { C$t $ 蝛t&$\\D$á ߉D$!؉$(\0@1t ft&Xt<xu|Vu  ?v1\$t$l$$,[^_]$ $ Ě  {$ 覚1P0pP{[f'UWVS<|$PB=)Z]<t $ 蜙@$ D$D$D$D$# $ D$>%$ D$4 90 X x,EX@=tc=}2=|$.D$. fD$,l$,|$ l$.D$ ƍ=8 =u@==|$.D$. fD$,l$,|$ l$.t$ =8 0 L$8  L$Bjr JP0 <[^_]Í=E$W 4$ ԗ&ƍ=g=`X$ 萗Gv8    4 D$$8 \$$ D$t&D$$ ŋXD$@x\$$ TD$ ,$$I%¸\$ft&$ 褖w&$@ 茖$m t4 $)8 $ CD$+"&$>  VS$\$0@$ D$]ƋX}I<U\$$ D$ 4$"$¸t2$[^Ít&$< t<~$ [띐?v1\$t$l$$x묍S(\$0<K\$$ {D$$ "=?v1҉D$T$l$$([Ðt&$` ĔfVSD$ $1 D$'$1 ËD$$D$$1 ƋD$(D$t$$D$![^VSD$ $9 D$$9 ËD$$D$$9 ƋD$(D$t$$D$"[^Ã<P t L D$D$X <Í&؍D$ $"D$D$4 ` <Ð&D$ D$D$$ h  D$ ! D$h 0$! $mD$!ÃD$ d  D$D$$ D$ ! D$D$$ D$ D$d 0$! $mD$!Í& D$D$$ D$ p&'UWVS,D$Dl$@D$5@ 8 D$,$~]f 4$D$4$ ؅~3t& $ D$, $  у9|$t D$@,[^_]u,[^_]Í'UWVSL D$dL$h\$hT$< 1ˉT$8d )ˉT$4h T$(+T$`1)9{|$h+D$h9D$`D$$T$`D$hT$DD$ D$T$L$D$$\ @ T$ɋL$i\$ Xit$XD$ ƈ ffCFk{9tT$,$+T$9t<$ D$$D$D$9@ D$D$$D$ 9D$,T$($XD$hT$$D$$ $D$8D$D$<$aD$4$T$4D$(d h L[^_]ËD$`T$$4tT$`+T$h9ЉT$0T$hD$ ‰T$$D$ T$L$D$$@ L$ҋT$D$ i\$$XD$iXD$,  fCFk{9tT$,$T$9t<$ D$$ D$D$9@ D$0l$ l$$9D$,T$($D$h؉D$D$`$ $~fD$ D$,맍v,$ $ , 0 <  @ Qt'D$ D$$P '*$ t'D$ D$$P @ P 'w@   P@ P4 1=$  ( % 8   ,Ðt&D$D$D$T$ u@D$T$ @ >@   d~ dd@  D$ D$$Í'D$ D$` D$$%l w Í'D$` D$$ l  w _ D$ $5 `  d  h  l  p  t  v x  |               t&WVS\$ $Zx94>\t5Ɖ <$D$9D$^D$^D$_$覴 uD$4D$D$0$1 $ ؃= t@Ƌ@$!';5 ;=@ NiX\ J   ىJt&:ءD $ $ \$D $ ؉$؉$[؃= t~ D D ػ؉$؉$+|؉$k؉غUV؃= t$貺0ÍD$H$述D$HFD$LF ؋< < ؉ػ\ ؉x;$ | $ Q}l Yp  t 9|# t L$$̹p l p cءH t$訹}H %؉$ P҉< ( u < ( ؃= tu$ 1M$ 5؋P T$PT$@$o\$$ D$$ >؃= t$_؁\$@D$@\$PD$P{؋P T$PT$@$؉غ\$t$D$ $ $ {D$t&B B1ҁ[\$PI1ҁ\$X  $> z$ z$D$D$D$4$? V\$$ >zD$ $\$H $脀w$ 1zd$\ ySt $襶p l t& t& qUWV5@ S\$kd,.} tN= t9u 9t$kd ADu= E[^_]ft[EDADߍv= t!9u Bt&9t$kd ADu= E[^_]ftEDADߍv}D뇋}Dҍ&'VS$D$0D$=D$}=|q5H ~0@ St3Sd1BӃdt!9؍t&$[^؋St0uސ\$$D 0xD$낍v'SHH D$P~* @ 1Qt?1fAhdt39|\$\$$D$^ $wH[v؉ЃH[ UWVS,D$@D$=D$}=$J5@ kd0 <> G_4tP- t!9u f9t$kdSDu- ,[^_]Ít{GDCDߍv- t!9u et&9tDkdSDu- ,[^_]Í\$$D vD$-&tGDCD뿍voDdoD믍t&'UWVS,D$@\$D$ D$;$   <t $x )viW$D$9t(T$ D$D$ $ $ u-H <@ 1ҿD$xD$td9t$xuH`9~T$d9u㍴&|$k|$dD$PPt$@ PH+x PP0P@ P$@X,@<0 X4@@@DXH}T$B@L@T@X@\@P@` u8 H 5@   &Ʌ~&V1҉uPAhdtC9P 8 vx \$@,[^_]`ϋ ɉ @H$e@ P x \$@,[^_] x \$@,[^_]$ s$Ƨ sO@ T$T$-H kd$l$H kd@ t& x t- w1 vfx  f H % ~ס@ 1ҍt&@,X,@4X4d9uf x ux   Ív'WVS $nH -ۉD$~F11ۍ|$@ xt@$<$D$D$D$nd9H ƋD$ [^_Ít&'UWVSLD$`t$dD$8=D$8}=$|Tfkd-@ t5~ ~@~F FL[^_]Ít&<t $ rqpx$ Mqt&|$8D$8} t$8D$8}fkd@ Rp  | @ i|$>D$>fD$v4$ pp#vv  &ؿ$@ -pbkd|=D=  FD [t&B@R$\$\$ =@ 47~ D$^,D$ ^4^ ~t5F FL[^_]Í&okdl/D-  FD \$ $ XoD$ a&B@ʚ;K\$\$ $ "oD$ D$v\$\$ $ nD$ D$t&= 9u9kdL ADuf- 9u 9kd ADuv|$>D$> fD$6l$6\$8l$>|$8uvkdD(DADF = s&kdD8DADF - D&\D$`|$LD$L% fD$Nl$Nl$L T |$ND$N% fD$Ll$Ll$Nwf|$>D$D$> fD$ɉ$l$\$\$ D$ @ D$ \$D$T$0vt&D$0w\Ív'WVS0 x  D$@ɉ ,+ @ kd41ϋ^DF4uD؋^Dt&kd41F4sىڋ^Dukd 41D F,9kdy F@F<9^tukd8 ߉GLh G`D GPD GT  GX, G\FL38 FPh FTD FX  F\, @$8 0[^_Ðt&t&ɍt& Jkd @ x<~Nt&kdp<;XDukdX@X<@Du t7 @ &ډ kdύ41~ ًD \$\$ $V  @ D$ D$붍F<y_D$$` $8 | | kD d@  H vA<t&$F =@ kd473 t&kD d@ JuB<~BYTREWQ unknown commandexit must be inside a loopunknown with/without option।warningtraceprofile_time-_profile_time_profile⨯_type_checka type is expected herea name is expected hereStatement_listabort()SetPSexitreturnExpronly %s takes %s%d argument%s%s has not been declaredunknown opcode: %dV~EFKOd& #9LMN o%5 G8c,$3nm:;=X+ZYWthis ...'?''while''without''with'a variable'type'a type'then''to'a character stringa slice'return'']'')''}'a procedurea function'procedure''+''or''!=''not'end-of-linea namespace qualifier'*''-''<=''<''[''(''{''include'an illegal character'if''>=''>''global''function''for''exit''='the end of file'end''elsif''else''do''/''constant''&'','':''by''!'a number'and'missing namespace qualifierfile name is missing  "number not formed correctlyexponent not formed correctlyunknown escape characterinclude EUINCcan't open %sillegal character (ASCII 0)%s %s in %s is %s%s %s in %s() in %s is %snever assigned a valuenot usedlocal constantprivate variableparameterlocal variable楫integer᫮ꥪobject_toplevel_extern int _%d; /\:attempt to redefine %s elseif %.16esqrt(-1.0)(1.0/sqrt(0.0))space_usedᮯ⠢______⮯__ᯨ᮪_⫮__㣮_६_ଠ_ணࠬࠢ䨫___4_맢_㭪맢_楤ணࠬ_㭪_楤__஢_梥_祪窨_⭮_⭮_⭮⠭__맢____ࢠ設_楤設_㭪⥯⮪_ᨭ७_㦥_பᮯ⠢ࠢ砩_᫠__ப_楫__࠭__ଠਡ뢥match_fromfind_fromtask_clock_starttask_clock_stoptask_statustask_listtask_suspendtask_selftask_yieldtask_scheduletask_createplatformsystem_execequalpeek4spoke4call_procroutine_idc_procmem_setmem_copyget_pixelnot_bitsxor_bitsand_bitsarctansprintfcallpokepeekabortmachine_procmachine_funcpowerremainderdatesystemcossinsqrtgetenvclosecommand_linematchfindcomparerepeatrandget_keygetsgetcfloorclear_screenprintprependappendpositionputsᥣ_᫨横뤠xorwithoutwithnotbyglobaltowhileelsifdoforthenInternal Error at %s:%d - %s Internal Error: %s %s:%d %s ^ Warning: %s \/:/LinuxWIN32DOS32DOS32 built for DJGPP3.2.00.ru%.10g \n\t}{ ணࠬInvalid routine id%s() does not return a valueinvalid routine idfor-loop limit is not an atom⪠ 0 ()attempt to divide by 0⪠ 祭 ⮬attempt to slice an atomslice length is less than 0 ⮬ ॡ 樠not initialized=== ====== THE END ===Couldn't open ctrace.out訡 ⨯ %s -- type_check error %s is Enter... Global & Local Variables --> ᬮ --> see ⨯ in type 㭪樨 in function 楤 in procedure 譥 ணࠬ external program Windows ^^^ 맮 ^^^ call-back from ... 맮 < 稭> Can't open Enter %s ⠪ 몥 㬥 ⨯ SetPS - ⭠ 業⮫쪮 %s ॡ %s%d 㬥%s %s ⨬ 樨: %d 䠩楤 Scanner()᫮ ᠭ ୮ %s%s %s %s - %s%s %s %s() %s - %s 稭 ᯮ⭠ ६㬥⭠ ६⭠ ⠭⪠ ८। %s७ 訡: %s <-䠩> : %s Linux ᡮઠ GCCWIN32 ᡮઠ OWDOS32 ᡮઠ OWDOS32 ᡮઠ DJGPP 䠩 ᯮ? 32-ࠧ來 DOS. 32-ࠧ來 Windows. DOS/Windows. Linux. FreeBSD. Linux/FreeBSD. rblanguage.eri3.2 file name to translate to C? See http://www.RapidEuphoria.com/License.txt Copyright (c) Rapid Deployment Software 2011 A number from %g to %g is expected here - try again A number is expected - try again function result must be assigned or used'global' must be followed by: , 'constant', 'procedure', 'type' or 'function'sample size must be a positive integercan't mix profile and profile_time%s is not supported in Euphoria for %stype must return true / false valueno value returned from functiontypes must have exactly one parameterbadly-formed list of parameters - expected ',' or ')'expected to see a parameter declaration, not ')'a parameter name is expected herebuilt-in routine %s() redefineda variable name is expected herea loop variable name is expected hereexit statement must be inside a loopreturn must be inside a procedure or functionSyntax error - expected to see =, +=, -=, *=, /= or &=may not change the value of a constantmay not assign to a for-loop variableSyntax error - expected to see an expression, not %s%.99s:%d - call to %s() might be short-circuited'$' must only appear between '[' and ']'A namespace qualifier is needed to resolve %s. %s is defined as a global symbol in: Syntax error - expected to see possibly %s, not %s%s:%d - statement after %s will never be executedStatements have been inserted to trace execution of your program.improper syntax for include-asa new namespace identifier is expected heremissing closing quote on file namecharacter constant is missing a closing 'single-quote character is emptytab character found in string - use \t insteadhex number not formed correctly#! may only be on the first line of a programend of line reached with no closing "fractional part of number is missingonly one decimal point allowedan identifier is expected hereprogram includes too many filesincludes are nested too deeplycan't find %s in %s or in %s or in %s%sincludecan't find %s in %s or in %s%sincludeout of memory - turn off trace and profile ;@^`|~((1.0/sqrt(0.0)) / (1.0/sqrt(0.0)))___4______4___Can't create error message file: Press Enter to continue, q to quit 맮 ਩ ணࠬ 㦥 crash routine requires a valid routine id맮 %s() ॡ %d 㬥⮢, %dcall to %s() via routine-id should pass %d arguments, not %dᯨ᮪ 㬥⮢ ⨯ argument list must be a sequence१ 㭪樨 %s() ᢮ ᯮ짮the value returned by %s() must be assigned or used㭪 %s() 뤠 १饭 横 for ⮬for-loop increment is not an atom। 横 for ⮬६ 横 for ⮬for-loop variable is not an atom᫮ ⨭/ true/false condition must be an ATOM⮪ 0 () Can't get remainder of a number divided by 0 ⨯ ⮬ (ᢠ 稭 鸞)subscript must be an atom (assigning to subscript of a sequence)祭 稢 殬 鸞slice ends past end of sequence祭 稭 殬 鸞slice starts past end of sequenceᢠ 稭 १ - 冷 ᮢlengths do not match on assignment to slice १ 0孨 祭 0slice upper index is less than 0孨 祭 ⮬slice upper index is not an atom 祭 1slice lower index is less than 1 祭 ⮬slice lower index is not an atom稭 %d ࠭, ᢠ 拉 %dsubscript value %d is out of bounds, assigning to a sequence of length %d ⮬ (ᢠ 拉 %d)subscript must be an atom (assigning to a sequence of length %d)⪠ ஢ ⮬ (ᢠ ⮬)attempt to subscript an atom (assigning to it)length of an atom is not defined稭 %d ࠭, ⥭ 鸞 %dsubscript value %d is out of bounds, reading from a sequence of length %d ⮬ (⥭ 鸞)subscript must be an atom (reading an element of a sequence)⪠ ஢ ⮬ (⥭ ⮬)attempt to subscript an atom (reading from it)⪠ 室 㭪樨 뤠 १attempt to exit a function without returning a value 㤠 䠩 ctrace.out ६ ^^^ 맮 ࠡ⪨ ਩ ⠭ ^^^ called to handle run-time crash ᨬ 室 ᫮ ⨬ exit- 横१ 㭪樨 ᢠ ᯮ짮'type-⨯', 'function-㭪' < 짮⥫᪮ ⨯>'constant-ᥣ', 'procedure-楤', 'global-' ᫥: , 'constant', 'procedure', 'type' or 'function''global' must be followed by: ⠪ ० with/without ࠧ 롮ન ⥫ 楫⨯ 뤠 稭 ⨭/㭪 뤠 稭⨯ ⢥ 㬥ୠ ଠ ᯨ᪠ 㬥⮢ - ',' ')' । 㬥, ')'८। ஥ ணࠬ %s() ६ ६ 横 return-뤠 ணࠬ =, +=, -=, *=, /= &=ࠧ 稭 ⠭ ६ 横 for ⮫쪮 ⮬᪨ ࠦ, %s%.99s:%d - 맮 %s() 㪮祭 楤'$' ⮫쪮 '[' ']' 㦥 䨪 %s. %s  쭮 : , , ॡ %s, %s%s:%d - ᫥ %s 㤥 믮୮ ᠭ include-as 䨪 䨪 䠩 뢠 窠 ᨬ쭮 ⮬ 뢠 窠 ' 祪 ⮩⭠筮 ᫮ ᠭ ୮#! ࠧ襭 ⮫쪮 ࢮ ப ணࠬப 窮 " ப ⠡樨 - ᯮ \t, ୠ ᯮ樠쭠 ଠ ᫠ ஡ ᫠⨬ ⮫쪮 筠 窠⨬ ࠢ騩 ᨬணࠬ 砥 ᫨誮 ⥪㡨 ⥪ ॢᨫ ⨬ %s %s, %s, %s%sinclude %s %s, %s%sinclude⨬ ᨬ 室 (ASCII 0)७ 訡 %s:%d - %s %s ࠡ⠥ Euphoria %s ᮧ 䠩 ᮮ饭 訡: 誮 ।० - 뢮 ⠭Too many warnings - no more will be issuedRDS - Rapid Deployment Software - http://www.RapidEuphoria.com Rapid Deployment Software is not responsible for any damage. RDS ⢥⢥ ਬ 襩 設. http://www.RapidEuphoria.com ⠭ , ।⠢ RDS, ࠡ⠭. Source code provided by Rapid Deployment Software is changed. Euphoria Bilingual Euphoria Interpreter AC`@gݵ tgݵ t-DT! @BAC;B$@AAK@@B@FAA7PB@AAAB@A@@-C6?J@@c_proc/c_func%s does not return a value%s returns a valuec_proc/c_func: bad routine number (%d)c_proc/c_func: argument list must be a sequenceC routine %s() needs %d argument%s, not %dThis C routine was defined using an invalid argument typearguments to C routines must be atomspassing an integer where a sequence is requiredpassing a sequence where an atom is requiredpassing an atom where a sequence is requiredBAD IL OPCODE: i is %d, word is %d, len is %d type_check failure (type returned a sequence!), argument to rand() must be >= 1call to %s() via routine-id should pass %d argument%s, not %dfirst argument of append must be a sequencefirst argument of prepend must be a sequencesecond argument of position() is not an atomfirst argument of position() is not an atomargument to peek() must be an atom or a 2-element sequencenumber of bytes to peek is less than 0first argument to poke4 must be an atompoke4 is limited to 32-bit numberssequence to be poked must only contain atomsfirst argument to poke must be an atomargument to call() must be an atomargument to trace() must be an atomargument to trace() must be 0, 1, 2 or 3argument to profile() must be an atomargument to profile() must be 0 or 1argument to abort() must be an atomUNKNOWN IL OPCODEcall_proc/call_funcpeek4s/peek4u%.20s:%d %.80sHjmmmmmmHmmmmmHmmmmmHmHmHmmljjmmmkHmkkkmHmxkmHmmmhkHmHmHmxkHmkkmhkhkhkHmhkmhkhkmmjxkHmjHmmkxkmHmHmkkmmHmHmkmmmkHmHmHmHmmmkkkxkkHmmmHmkkkmHmkkjjjjjjmkjmHmHmmmmmmjjjjjjlkHmHmkHmHmmmmk(nxkHmmHmHmHmjHmjHmHjjjHjmkkmmmkHjmxkxkHmkmkmkkmHmxkkkkHmxkxkkk?Aex.procan't open ex.pro -- Execution-count profile. | |%6.2f |%6ld |debug.logCouldn't open debug.log %gwbctrace-d.out%-78.78s ,TERMxterm Press Enter... call-back Fatal run-time error: system() command is too longopen mode must be a sequenceinvalid open modeabubconfile number must be an atombad file number (%ld)file number %d is not openUnknown printf format (%s)argument to rand must be >= 1can't raise 0 to power <= 0repetition count is too largeinternalmath function %s errordomainsingularityoverflowunderflowloss of significance Writing profile results to ex.pro ... -- Time profile based on %d samples. -- Sample buffer overflowed - increase size! -- Left margin shows the percentage of total execution time -- consumed by the statement(s) on that line. -- Left margin shows the exact number of times that -- the statement(s) on that line were executed. * Press Enter to continue, or q to quit Press Enter to continue, q to quit first argument of match_from() must be a sequencesecond argument of match_from() must be a sequencefirst argument of match_from() must be a non-empty sequencethird argument of match_from() must be an atomthird argument of match_from() is out of bounds (%ld)second argument of find_from() must be a sequencethird argument of find_from() must be an atomthird argument of find_from() is out of bounds (%ld)attempt to move cursor off the screen to line %d, column %dsequence found inside character stringargument to getenv must be a sequencefirst argument of system_exec() must be a sequencesecond argument of system_exec() must be an atomfirst argument of system() must be a sequencesecond argument of system() must be an atomdevice or file name must be a sequencefile name for open() is too longcan't open -- too many open fileswrong file mode for attempted operationnot enough values to print in sprintf()not enough values to print in printf()format specifier is incomplete (%s)number is too big for %x or %o formatslice lower index is less than 1 (%ld)slice upper index is less than 0 (%ld)slice length is less than 0 (%ld)slice starts past end of sequence (%ld > %ld)slice ends past end of sequence (%ld > %ld)lengths do not match on assignment to slice (%ld != %ld)first argument of match() must be a sequencesecond argument of match() must be a sequencefirst argument of match() must be a non-empty sequencesecond argument of find() must be a sequencesequence lengths are not the same (%ld != %ld)argument to rand must be <= 1073741823may only take log of a positive numberattempt to take square root of a negative numbercan't raise negative number to non-integer powerbitwise operations are limited to 32-bit numberscan't get remainder of a number divided by 0repetition count must not be negativerepetition count must be an atom      Y@A[col corrupted (%d)line corrupted (%d), s is %s, col is %dYour program has run out of memory. One moment please...true/false condition must be an ATOMsubscript must be an atom (assigning to subscript of a sequence)attempt to subscript an atom (assigning to it)variable %s has not been assigned a valuesubscript value %s is out of bounds, reading from a sequence of length %ldsubscript value %s is out of bounds, assigning to a sequence of length %ldRuntime error (Traceback unavailable)%.300s:%u%.300s:%u in %s %.99s() %s = %s = %5u==>%5u: Can't create error message file: Too many open files? (%d) initial task TASK ID %.0f %.99s ---------------------- %.99s%.99s is ^^^ called to handle run-time crash ^^^ call-back from external source ... called from ... (skipping %d levels) %s: Traced lines leading up to the failure: %s:%u %s --> See %s= * Press Enter to resume trace %.20s F1=main F2=trace Enter down-arrow ? q Q !variable name?- not defined at this pointprogram aborted type_check failure, A machine-level exception occurred during execution of this statement%s: an integer was expected, not a sequencein machine_func an atom was expected, not a sequenceBACKEND requires a sequence of length 4call_back() argument must be routine_id, or {'+', routine_id}for cdecl, use call_back({'+', routine_id})call-back routine must be a function or typeroutine has too many parameters for call-backfirst argument of define_c_proc/func must be an atom or an empty sequenceexpected {'+', address} as second argument of define_c_proc/funcroutine name must be a sequenceargument size list must be a sequenceargument type may not be a sequencevariable name must be a sequencename for open_dll() is too longcurrent directory not availablethird argument to put_screen_char() must be a sequence of even lengthinvalid routine id passed to crash_routine()machine_proc/func(%d,...) not supportedthe first argument of machine_proc/func must be a small positive integerthe first argument of machine_proc/func must be an integerget_pixel()sequence has wrong lengthbackendcall_back: bad routine id define_c_proc/funcmachine code routine at %xroutine name is too longInvalid argument typereturn type must be an atomInvalid return typevariable name is too long[4INESCOLUMNSname for dir() is too longdraw_line()ellipse()all_palette()freefile must be open for seek()seekfile must be open for where()where() failed on this fileput_screen_char()get_display_page()set_display_page()set_active_pageallocate_low()free_low()dos_interrupt()use_vesa() d d d d d d d yd od d [z Wx x Fz .z z Vy 7y y wy y x | z ~ x { y{ V{ } K| 6| &| | x  *   | x z z 8~  C   Wx w w w t ] Ђ | M  x   ۀ ʀ   x j .  P~ x } |} gz  | {   a task id must be an atomInvalid task id: %10.3gspecify the routine id of a procedure, not a function or typeArgument list must be a sequenceIncorrect number of arguments (passing %d where %d are expected)task id must not be a sequencenumber of executions must be an integer value greater than 0second argument must be {min-time, max-time}min and max times must be atomsmin and max times must be greater than or equal to 0task min time must be <= task max timeu<7~s?C& .>ư>?(knN   æ  ͦ E  ɦ  Ʀ       ʦ  Q         J   A Ҡ : 2 , o        Y     ۥ  ե a Υ ɥ ť  j          { v n g ^ V U L F B 9 1 * O            Ӥ Ȥ      z :Z l L oH||    ooo ŠҊ"2BRbr‹ҋ"2BRbrŒҌ"2BRbrҍ"2 Jߜ  ɚ; ɚ;Pɉ{]jw|{(}^vɄwmqq_ vď8t6tk!3VjNuu~$zyPỳUuz o#mA{  ~Q~w)zz0WzzzzxvDLwǝ-v}3xa}}iġ}d.~}B5zЇw]*|#=2s߈kТlK(r rg‹qq-/9;y wĕ ~xyByxy] P?W< `p0@@P^ p^ ^ / /  . - * *  - . ) p) P/ / +  + `*  * `@  `   4 {Gz??GCC: (GNU) 4.4.3@"!qu_IO_stdin_usedm@b../sysdeps/i386/elf/start.S/home/qateam/rpm/BUILD/glibc-2.11.1/csuGNU AS 2.20.51.0.7yQdd[C61Eint,Ll O%% $ > $ > $ > 4: ; I?  &IW2 ../sysdeps/i386/elfstart.S@3!4=%" YZ!"\[# init.cshort unsigned intshort int_IO_stdin_usedlong long unsigned intunsigned char/home/qateam/rpm/BUILD/glibc-2.11.1/csuinit.cGNU C 4.4.3long long int.symtab.strtab.shstrtab.interp.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_str#(( 1oHH4; ||C||KoXog  p  yll 0t @@ L Lh hU o p p p p p p q  { 0{{ {%{|_B} 0}^~+܄Pe! ,:(H|| l  @ L  h           , : Gp ] l zЎ       #.9DKValw n o `    ( + 6 > I V b k w ~  ` $   X @ q , \ ,  5 [  ` , $( 1H ?L MXcnt +x z? # ? 3  ?   @  A Y xA 8   A j h ` H (T :L JP [d ep nFK = t, {  X dQ  D |   \ , p_ P ` g #`a s 1@ 6t  :F O X q cx p xx   |   Ɩ x      ` d (X   ! 2 E N`w            > >    0    0P]  =+ IPE [ ` e j pF& yu  @&    * 2   \   U p   "2  < B Gt Q W ]  c$ h( m, x0 ` 4 8 F /R  Y  < ` u @: c @ D b C H  L  P   ( T . X 4 \ : ` ? d D h I S l Y & i p o t u x z |      8              ` p       a    $  )  /  5  :   I `E P @   Z  _  e  k  q  y  ~         2      0 @              !  ' p\ 2  8 & @  F  R  W  `  e  @o  u @    "      x   P< @w  T 5   ,  1  7 $ = ( C , J  T  ` 0 q 4 v @& ! 8  <  k X   @  D  H  2 o H  L  P  T  X  \  `  0   @  d  h * l / p 4 t : x @ R  ] t h { @^ 0 > _ |  $        v        ) .    $ ) 2 A EU Q V   a9  kh r ^ |  p  `* 6   H     ; P ` " &, , 0 ?r> ) G [ a g k z p  0_     X        `g    \ + 1 6He R ` p @    2Ps 1 L    <  $ ( ( p  #, 60 < M4 Q8 a< g@ lU ~D   H s  L P T @ X T  , \ ` pr pp @ ! / 6d ;h @l ETp YPh dt jx x|      p y  @     0< h        ( . ;  D J P U0 Y c i o z  p  \  r #    D         $ * 0 6` % C  X$ ^r, ( , 0 4 8 ] H < @ D H L P  V fL  -K  T X \ ` & .P\ 9U Kd Qf`k p ph u0 p  l p p t  x |              % +  4 : ? E K M a8  n@ v  {    p^ 8      Pjd   ` 7   4   ! ( .t=  ? E  R W0 c i  m r x   P\ p&   $ ( l , sS ]  \ Г 0 4 (: D8 R` _< d@ i yD H L P T X \  8 ` B  d  h H l   p  t x |  # ( .`- 8 =$ B0 M Y> d( j o } {G 4    m          T    -  !2 = B P V \:.  p ~      (  +  P- pZ  ~  2   & * 0  >?>  M \m     ``  `     $  ( , 0 4 8  < % 4@ 9  ED K Zlr wDY H / B L  P  0  T  X  \ ` -X 9d >h Cl Ip Mt R0 X, gx m| {   a>    b[ * 6     OE          % +< 1 6 ;@ D J Pr V [ a g m s0 4        @  `    p 4 ! ( 8 < G Y` <` K h w  3     P Px  5  j    +  1 B  G  L  X ^ L i $ n ( s  0  ,  0  6 U 4   0  8  <  ;   @ !D !H ! $!p7 h 2!L 7!P =!k  G!fP  U!T Y!X m!% r!\ x!J8 !` !d !h !l !p !t !x !| ! ! ! ! ! ! ! !\ !4 ! "  " " " )" ." 3" 9" h  F" K" Q" U" Z" `" f" l" w""T K ""c " " " ""d " " # # # $# *# Z :# E# K#0/ _# -  i# r# w# }# # # #p # #U # # #/ #D  ## $ $ $$ $( $,  $0 &$4 ,$ 6$p) r >$p K$P,k U$P_  _$8 e$< n$` v$@ |$P/ : $ $D $H $L $P $T $X $\ $\ $`_  $ f $` $d $h $l %p %t %x $%| ,% ?% E% P% V% \% `%0\ k%h r% x% }% . n % %8 % % % % %q;Y % %< % %< % & &  & & & & #& )&8 .& 4&Pt m =& H& _&X k& p&/ o w& }& & `&P] & &, &< & & & &Ѐ% & & & &'E ' '# , '0`~, ('h 5'G' V'pB ]' b'P p' v'@ ~'=  '`  '@ ' 'D '=  ' ' ' ' ' ''$ (( ((, ( ~ .(0 4(& C(@  M(4 S(8 c(< h(@ n( }(D (H ( ( (L (P (T ( ~ ( ) (X (\ ( ( ~ )` )-)d 2)h I)l M)p Q)( `)t d){ k)o  z)x )| ) ) ) )P % ) ) )H ) D" ) ) ) ) ) ) ) )P0 W )Ѓr * * +  *@h #* 0*  4*  ?* D* I*. n S* \* b* h* m* r* x* * * *< F * * X [ *  * * *8 * * * * * *D +  + + + +@j ` &+ pP 0+ 5+ ;+L+ R+G [+ a+ g+ m+p |+X + + +\ +0 & +@ + +* +$ ++( +, +0  ,i ,4 !,8 %,< ),D 5,: J,e  R,@ X,D ^,H c,L i,C  t, ,p  ,,@ , ,P ,T ,X ,0 ,\ ,` ,d ,h ,l -p  -t -x -| -,- 2- ;- J- S- X- ^-` d- i-$ w-+ - - -> i - - -@ - - - - -< .  . .  . &. ,. 6. F.Y. * : `.m = j. p.\ 2 z. ~. . . . . . . . .P   . . .` . . . . .pf . . / /  / / /+/ //  d0d j0h w0/ K 0l 0 0p 0 0 <0 0_  0t 0x 0 0| 0 0 0Pu 0 0 0 0 1^ 8 1h 1 #1 )1@_  91 Y H1 N1 T1 Z1i  e1 s1`  ~1d 1 1 1H 1 116 1 1 1 10h 1 1 1 12 2 l 2 #2- n -28L . ;2 A2 R2  Z2$ A _24 n2 t2 z2_  2 2 21 E 2 2 2\ 2  2D 2 2 2 2C : 3  3 3h 3 *3\ 23l  >3l H3  N3 T3 Z3 _3` e3 M p3  z3;   3 3@ 3 3 <3  3$ 3( 3> _ 3Р& 3, 30 3Ы 34 3 48 4< 4@ 4D $4H 04L A4 ) O4 5 X4P ]4T b4 o4G" z4X 4\ 4` ? 4` 4d 4h 4L 4< 4l 4p 4$ 4t 4@`  4 4x 5| 5i n 5 5 5 $5 ] .5$ =5 C5 I5p T5 Y5 e5 k5 q5`N 5 5 5 5 5t 5 5 5 5 5 5 5X  5 5 5(  6 6 "6@e  /6 56 F60- P6a6 g6 l6k 6 .g 6 6 6 6 6 6# 62  6 6@R 69  6 6 7  7 7 7  !7 '7 07 57 ;7  A73 T M7& \7$ a7( f7, k70 p74 u78 7 7@ 7< 77@ 7j ` 7D 7H 7s 3 7 7L 7P 7T 88X  8\ %8@  -8x 78` E8d K8K  W8^ 8 ^8h d8l m8p q8t 88x 8p 8| 8 8 8 8`B 8 8  8 8 8 8 9L 9 "9 (90 /9 :9 @9 E9 J9 X9 f9 q9 w95 9 9 9 9pU 9  9 9 9 9 9 9  9C 9 9 P :@ `: : : %: *:;   2:l 8: & >: B: G: L: R: _: d:5 k: }: : : : : :D  :  : : : init.cinitfini.ccrtstuff.c__CTOR_LIST____DTOR_LIST____JCR_LIST____do_global_dtors_auxcompleted.6991dtor_idx.6993frame_dummy__CTOR_END____FRAME_END____JCR_END____do_global_ctors_auxint.cmain-.cmain-0.cinit-.cwildcard.cfe_err_r.cmachine.cfe_sym_r.cfe_sca_r.cfe_sca_0.cfe_emi_r.cfe_emi_0.cfe_emi_1.cfile.cfe_par_r.cfe_par_0.cfe_par_1.cfe_prs_r.cfe_bei_r.cfe_run_r.cfe_pop_r.cbe_cal_4.cbe_exe_i.cstring_ptrrecover_rhs_subscriptrecover_lhs_subscriptlocaljumptab.5362be_rtm_i.csample_overflowtotal_samplestrace_filetrace_linethe_endprint_fileprint_prettyprint_linescut_lineprint_widthindentprint_levelprint_startrPrintshow_asciiuser_abortdoCharCheckSlicecheck32CSWTCH.431be_scr_i.cmust_flushexpand_tabsexpanded_ptrexpanded_stringcollect_freecollect_nextout_to_screenerr_to_screenbe_run_i.cbe_mem_i.cbe_rer_i.cfirst_debugLocateFailsf_outputscreen_err_outTracePrintTPTempBuffDumpPrivatesset_bk_colorSetVarPositionvars_per_linenum_trace_linesDisplayLineMainPosMainColdebug_screen_coldebug_screen_linemain_screen_colmain_screen_lineMainBkColMainWrapT.198blanksdisplay_listdisplay_sizetstampRefreshprev_file_nohighlight_linevar_linesconinDebugScreenSavebe_sym_i.ce_routine_sizebe_lin_i.cbe_mch_i.cget_intfpsequencefloat_to_atombl20Dirbe_tsk_4z.cts_firstrt_firstwhich_tasknext_task_idid_wrapclock_stoppedsave_clockearliest_taskcode.4798be_syn_i.cchar_classflushcolorseg_endseg_startlinesegmentkeywordpredefinedBRACKET_COLOR_GLOBAL_OFFSET_TABLE___init_array_end__init_array_start_DYNAMICfileno@@GLIBC_2.0getpagesize@@GLIBC_2.0fe_set_pointersdata_start_5253fputs@@GLIBC_2.0_11char_class_249_2924_5257_1440_1727_5057_1334INT_Handler_1496_86_15CreateTopLevel_14emit_assign_op_5338_9main_name_numValidPrivatemake_atom32_18ProcessOptions_299_173_130_3394_15cexpr_11IncludeScan_4qqq_option_14emit_addr_415_8keylist_1410sprintf@@GLIBC_2.0De_sqrt_1194_1144call_back7_11current_source_4587_14TempKeeppoke4_addr_334_784open@@GLIBC_2.0_12my_dir_4590_193poke_addr_1681_1274_1190_295_250_11id_char_16mem3in_from_keyb_741_14op_info1_11read_line_14emit_opRTLookup_10BLANK_ENTRYtask_listbe_init_1270_16MAX2BCallBack_3pretty_chars_4version_name_53_15PatchXList_5296_1148_1248_454_221_161key_write_5260_15EndLineTable_1244_1344_373_411_11shebang_4Argveu_dll_exists_2998_2916_1390_2994_2912task_createde_referenceget_pos_int_1348__libc_csu_fini_1394sysconf@@GLIBC_2.0start_backend_169_124_5264_3857_450_6ShowWarningscall_clong_open_258_5039_1316_1474il_file_264DoubleToInt_2894get_key_15Exit_statement_3pretty_line_countSetPosition_1444_5329_10InitSymTab_start_3pretty_dots_338_1448_426_1164e_tansystem_call_1198call_back3_2164_14Push_1470_14cg_stack_364_15elist_229user_file_2890_15TypeCheckinit_class_10lastintsym_15InitGlobals_4SIZEOF_VAR_ENTRYcall_back_result_19input_stringtemp_d_6screen_output_16compress_18fe_run_15Statement_listlast_r_file_no_360_1116_1160_1260_4EDOSRHS_SliceTempErrFile_4PATH_SEPARATOR_463binary_op_1264_232current_timelast_r_file_ptr_1278_1398crash_msgscreen_copy_128_4mybsd_79_34_3885_3598_2942EOpen_15WrongNumberArgstcb_11all_source_3pretty_file_158_115_2816_2936signal@@GLIBC_2.0expr_limitcrash_size__xstat@@GLIBC_2.0NewDoubleRangeReading_236SymTabLen_2946_1312_268RTFatal_273_629call_back_arg2_11LastLineNumberRandom__gmon_start___1478_Jv_RegisterClasses_14previous_op_1fn_6Errors_10atom_type_r_37_14TempFree_154_11ungetchInitInOut_fp_hwgood_rand_433_390realloc@@GLIBC_2.0_15Private_declaration_1130e_log_4Initializingmultiplyd_listtemp_dbl_1168_355_10bucketsNewS1localtime@@GLIBC_2.0_10NewIntSym_74minus_98con_was_openedNoValue_14current_sequence_2960_3798_70call_back_arg6_1268_14Popcrash_countRestoreConfig_4413_2898_11get_file_pathbase_time_10ExitScope_11new_include_space_1292_394_351_203Command_LineAppend_1296_1210allow_break_1370_109strchr@@GLIBC_2.0_6Warning_10DefinedYet_10literal_initgetenv@@GLIBC_2.0_17InitBackEndcol_max_15SC1_patch_10tmp_allockey_buffecho_wait_fini_119tmp_alloc_68_25system@@GLIBC_2.0strncpy@@GLIBC_2.0start_line_15UndefinedVar_10temps_allocated_4247assign_slice_seq_94_19ESCAPE_CHARS_1322_146_7atom_to_float64_101last_w_file_ptrTraceOn_2932InitGraphics_277_1450_285or_1326TraceLineNextDgreatereqexpr_top_3382_28_7allocaterestore_privatesfile_name_enteredwarning_countlesseq_187_142_6bppow@@GLIBC_2.0_444decompress_1182_15FuncReturn_15max_stack_per_call_15loop_nest_1134_387_1426_1422MakeCString_281eu_startup_89_20_448_403memset@@GLIBC_2.0SequenceCopy_1214_1138_7_3PI_6ThisLine_4OpTrace_3457_10e_routineand_bits_1218_1282_214_11EscapeChar_2514_2964_4EWINDOWS_172_15exit_list_14cont11ii_1386cdecl_call_back_1208EndGraphics_2968_3208_1382current_task_5339_196__libc_start_main@@GLIBC_2.0_85_3000_4TopLevelSub_137_4239_1378_1374task_suspend_4TRANSLATOR_VERSION_2958_IO_getc@@GLIBC_2.0TraceLineSize_289_246_1486_218_3pretty_ascii_minPrivateName_296_1454_4SLASH_15stmt_nest_1308_10last_sym_11IndexKeyDisplayVarRTFatalType_4593_176_133_1482_15AppendEListcall_back8_7atom_to_float32_5335tcgetattr@@GLIBC_2.0SetBColor_346AnyStatementProfileNewConfig_376_1186_10NewEntry_1458Concat_N_11ascii_part_14op_info2_292_4LineTable_52_1408_3773_5267_1286_1100_5295_7LOW_ADDR_16mem2_2091_3597xor_bits_1508_372_1200_2991x_4file_name_enteredflush_screen_15termDxor_2830_1352_160_412Dadd_15sample_size_15branch_list_46read@@GLIBC_2.0_1204_2950_11InitLex_259match_samplesfirst_mouse_10Hide_1300stack_size_494_451xstdin_5263_15For_statement_2954e_match_from_226UserCleanup_2165_19_255_1432total_stack_size_1304_10sequence_type_rcall_back0_14emitreaddir@@GLIBC_2.0_265_49_3pretty_end_col_IO_stdin_used_427ShowDebugArgvcall_back4_6ShowErr_164_9targetstrtol@@GLIBC_2.0Concat_Ni_9temp_indentclock_adjust_337_363crash_call_back_2223_1582_1500_1152_261_4563_1404xortpc_9indentmain0_1400free@@GLIBC_2.0ctrace_1120tcb_size_19ESCAPED_CHARSrhs_slice_target_41_3352_1232_1504_1156_525_1220debug_int_459rt00file_tracemake_arg_cv_15UFactorseed2_233_15init_stack_1236_14LexNameBacklink_2982_2900_11same_name_423_127_19ch_4425_1360_2986_2904__data_start_15Global_declaration_4lcc_option_157_6InternalErr_1460dlsym@@GLIBC_2.0_14lhs_ptr_460_14max_params_1356_2908_11AppendSourceLine_4shroud_only_1436call_back_arg1_1519Dlesseqfflush@@GLIBC_2.0_274_9c_codelast_s_14lhs_target_temppowerDoropendir@@GLIBC_2.0strcmp_insCheckFileNumber_110buffer_screen_73_1124_15InitDeleteatom_condition_10dup_globalsioctl@@GLIBC_2.0_3pretty_start_col_367_15ParseArgs_397_354Pixel_10name_extDnot_1170_270_5272_1128fseek@@GLIBC_2.0_15ExecCommand_77_32_97_15forward_exprmprotect@@GLIBC_2.0_1174_438current_screen_104AssignSlice_1254call_back_arg9isatty@@GLIBC_2.0_15putback_17BackEnd_468Ddivide_15forward_Statement_list_15PatchEList_1511Dequalstask_status_4gline_numbercall_back_arg5_15side_effect_callsInitExecute_1224_393fclose@@GLIBC_2.1_14InitEmit_430_182_2811_67_118boundclocks_per_sec_1228_14token_name_11my_sscanfSubsAtomAss_2974_4dj_path_15Procedure_calle_sqrtwrap_around_5042_1364_10integer_type_r_15NotReached_1250Waitgameover_145_14cont21d_2978_1494_3822slist_100_208Dgreater_2922_1490Print_243_1368_3040_1096_1468print_charslast_end_2926_445_400_1464_62_1178debug_logsample_sizealt_image_debug_200_358_341stderr@@GLIBC_2.0nanosleep@@GLIBC_2.0_6OpenErrFilec_routine_sizeequals_10NewDoubleSym_88_1messagesgeneral_call_backnewttyEPrintf_4num_routines_4cfile_countstrlen@@GLIBC_2.0binary_op_aupdate_screen_string_1522_3767_4OpProfileStatementclock_frequency_15InitParser_11ResetTPcode_set_pointers_1258_15backed_up_tok_5255fopen@@GLIBC_2.1_215_382_11bad_zero_3972shift_args_441_149_14StartSourceLinePosition_3pretty_int_format_56_11getch_14TempInteger_1342_15Assignmentc_routine_next_179_136ERealloc_3pretty_ascii_10object_type_1442_15SetWithscreen_output_408_5332SetTColorUpdateGlobals_80_4SIZEOF_TEMP_ENTRYDand_5251_15Expr_247_2918_349_252_1336_4NOVALUE_8_5055_1332_4389_1412_15not_supported_compile_1083_1498_5336call_back9clk_tck_1142_175_211__dso_handle_9CREATE_NAN2_375_332_1416_11path_open_191_3655_55_293_5294_1146_1192_4bor_pathstrcpy@@GLIBC_2.0DebugScreendlopen@@GLIBC_2.1_14cont21ii_1118_417_1272ftell@@GLIBC_2.0current_fg_color__DTOR_END___15short_circuit_B_16mem1_4933screen_lin_addr_5266__libc_csu_init_15mix_msg_1242call_crash_routinesDnot_bitsunary_op_223_1246_199_4line_number_2910_11NameSpace_declaration_1396_15tok_match_1346_4601de_reference_iCleanUpErrorchdir@@GLIBC_2.0_167_122_3PI_HALF_227_2996_2914_1476_1392De_arctanDRandomclock_period_15FactorESetTimer_2896_12SLASHoptable_5262eremainder_10hashfn_1472_256_2944_11IncludeStk_163_4566call_back1_2892tick_ratewhich_file_424_1166_6TempErrFile_2948_7check_calls_3pretty_indent_1318_4slist_14last_max_params_1196_2TO_LOWER_1070_1446_40call_back5setran_4551_379Dor_bits_14last_routine_idc_routine_1162_4current_file_no_4OpWarning_3781do_exec_44_01_4wat_pathalign4last_traced_line_366_618_262_16MAX3B_1114_456_1266rt01_1276name_ext_7MAX_ADDR_14lhs_subs1_copy_tempcolor_trace_738divide_5259_1262screen_image_14IsInteger_528addseed1_11main_pathExecuteNumberOpen_15If_statement_1290_420_2326closedir@@GLIBC_2.0_15InitCheck_113e_matchinit_literalversion_namefwrite@@GLIBC_2.0_6warning_list_12dir_238TraceLineBuff_2940collectInitDebugterminate_taskbad_samplesscreen_colexpr_maxInitEMalloc_35_1LANG_152call_back_arg8_1314fprintf@@GLIBC_2.0_2938_1324time@@GLIBC_2.0_1310task_clock_start_1132_15AppendXListfind_from_1328_4OpProfileTime_230_1428call_back_arg4_4256_16MIN3B_11IncludePopDe_tan_2962_103_19DIGITS_14good_stringsystem_exec_call_357_4CurrentSub__bss_start_15While_statement_11new_include_namemalloc@@GLIBC_2.0_271_1INTERPRETER__VERSION_76_31type_error_msg_92_14Top_11StringToken_435_465_1298_1212_1514EPutssymtab_set_pointers_15lhs_subs_levelfe_18full_path_7mem_1294_729_396_205_181_107Repeat_14emit_opndandDpowerAfterExecute_4wat_optionnottask_yield_470_439Dand_bitsnot_bits_2791_2352_209_279_1320_15start_index_19string_next_2934NewStringgreatereqFindLinePrepend_26_2930TopLevelSub_3pretty_level_1420_590_185_140cache_size_5058_287_244_442memory_setInitStack_381_1184fputc@@GLIBC_2.0_5345_15rexpr_1097_5184_1424crash_routinesTraceBeyond_15parser_1180AnyTimeProfiletask_clock_stopprofile_sample_61_6CompileErr_344dlerror@@GLIBC_2.0_1521_1136_4SLASH_CHARS_15Return_statement_65_22_83TempErrName_15emit_forward_addrDefineC_1284_5258_409_1216MainScreenstdin@@GLIBC_2.0InitTaskgetc@@GLIBC_2.0_14backpatchstack_base_14optimized_while_4659_5greater_5215_385_340_59_4SIZEOF_ROUTINE_ENTRY_1280_2966_503_170sleep@@GLIBC_2.0_1384_16max1bProfileCommande_arctan_148_1372noteq_178trace_enabledcompare_4file_start_symline_maxDisplayColorLine_9init_name_num_405De_sin_194show_ascii_char_11current_source_next_290control_c_count_2306_1452_10atom_type_1724_1376Executing_10SEARCH_LIMITmemmove@@GLIBC_2.0De_logdo_scroll_1380RoutineId_58_414_1302_1456_253_581_131_1480_1484long_fopen_19START_NUMERIC_370jumptab_1150TempBuff_212_348nodelaych_1306_1406_4237_5173_1088_190strcat@@GLIBC_2.0_50_15Expr_list_2980call_back6machine_6Cleanuphave_consolegetcwd@@GLIBC_2.0_785_378_335crash_list_1188_4630BiggerStack_15StraightenBranches_4549_418uminus_10NewStringSym_4Argc_2338_1230_end_1288stdout@@GLIBC_2.0_4w32_4djg_option_16mem0_16MIN4B_15param_num_453debug_msgSubsNotAtom_5261_4bor_optionDremainder_224eudir_331general_ptrsavettyDuminusWrap_1350_538De_cos_9CREATE_INF_11src_file_4eudirDate_4SymTab_139_166_121Dmultiplycurrent_bg_color_492_1388mouse_installed_20e_path_open_1206_5265_1202DefineCVar_14assignable_11MakeIntgline_number_1488_3591warning_list_2956tcsetattr@@GLIBC_2.0RepeatElem_2952_47_2465set_text_color_4Codepagesize_1430flock@@GLIBC_2.0_267De_floor_220Dxor_bitsErasePrivates_2972_4E_OTHER_EFFECTor_bitsfind_11pack_source_1402_1122Machine_Handler_3467_15short_circuitmatherr_7int_to_bytes_16MIN2Bcall_back2schedulersample_next_1506_1158_523InitTraceWindow_1222_619expr_stack_10object_type_rCleanupblank_linesProfileOn_1502_1154_4558_429e_sinCRoutineIde_routineEFree_2upper_15EnterTopLevel_43_00_4554_3pretty_fp_format_1234BadSubscript_15SubProg_3399_9c_h_10NewTempSym_457screen_line_10integer_type_462_2458_2888_16IL_START_11start_includetask_scheduleStdPrint_235_361rand_was_set_11Scanner_2984_2902not_supported_421_125_9novalueour_clock_tickslast_start_155_112e_routine_next_1354Get_Pixelmight_go_screen_239_1238OpenDll_1434_1358pool_mapInitFilescall_back_arg7_2988_2906TraceStack_432_15left_sym_3558_3902_15next_token_1438_151_38_9emit_c_outputmax_stack_per_call_276_391_4file_name_16current_db_369_9CREATE_NAN1Locate_edata_1176call_back_arg3_3pretty_ascii_max_71_10LintCheck_1126_10sequence_typedebug_dbltimes@@GLIBC_2.0_4572_399_15SetPrivateScope_11IncludePush_3pretty_line_3799_1256_1172key_getsConcat_gettextposition_436_15Print_statementscreen_show_15SC1_type_1252_466_91_6TempErrName_206_1226_4ELINUX_352_5040_1362ClearScreen_14emit_opcode_106_566_116_188_143_4INTERPRETER_VERSIONDlesslow_on_space_3562tolower@@GLIBC_2.0_1366memory_copy_14trace_called_471noechomain_path_2976_2190_14op_resultstrcmp@@GLIBC_2.0_5342_280EGetEnvfile_name_16comp_cache_1492EraseSymbolDminus_1338_4MININT_95_11AnyStatementProfileexit@@GLIBC_2.0_1462Dnoteq_2928_184last_w_file_no_29_7float32_to_atom_202config_1466e_floor_19input_file_1140traced_lines_7allocate_string_1565DeRef1_15factors_1414_388_343_4OpTypeCheck_19HEX_DIGITSpeek4_addr_1240_10keyfind_284_241_4074_10HideLocalse_cos_4temp_name_type_1418_10lastintval_447_402__i686.get_pc_thunk.bx_15aexpr_4078EClosealt_image_main_82_16CACHE0_1520mainEMalloc_initEGets_64_217less_1667_4cfile_size_384DeRef5_3pretty_line_max_134Argc_15LeaveTopLevel_11AnyTimeProfile_2920OpenErrFile_1330_406_197_1340